(data stored in ACNUC1104 zone)

EMBL: FN667742.PE67

FN667742.PE67        Location/Qualifiers
FT   CDS_pept        complement(73600..74403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0013"
FT                   /locus_tag="XNC1_0072"
FT                   /product="putative Protein tonB"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88160"
FT                   /db_xref="GOA:D3VG70"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88160.1"
FT                   /translation="MTHTAIFDNPTLISQKGLLISILIAILLHINLIWLFNRHTSYPDD
FT                   AAHHINNNASAMTLSITMVAASSWNHEPEPVSPPPPLLTAPESPTKPEIALDKAVHPEN
FT                   RVEKPQGSHKPKKRQKPQKEKPQEIAAKKPIQSTPVQKEINAETHGSDQVNSQSSMSRA
FT                   STSQPLVGQGKSEWDNYHARLRQEIEHHKEYPRKAKRMKQQGIVIINFTLLNDGTLTAA
FT                   KVVNSSGNSTLDNAALNAIHRARSVGVKPADIPSDVTLRLDFKLD"
     atgacccaca cagccatatt cgataatcca acgctgatct cccagaaggg tttgctgatc        60
     agcattctga ttgccatttt attgcatatc aatctgatat ggctgtttaa ccgacatact       120
     tcatatcctg atgatgcagc ccatcatatc aacaacaatg cgtctgccat gacgttatcg       180
     attacgatgg ttgctgcctc atcatggaat catgaacccg aacctgtctc tccaccgcca       240
     ccgcttttga ctgcccctga atcccctaca aaacctgaaa ttgcattgga taaagccgtt       300
     catcctgaaa acagggtgga aaaaccgcag ggatcccata aacccaaaaa acgccaaaaa       360
     ccgcagaaag aaaaaccaca ggaaatagca gcaaagaagc ccatccaatc aacgccggta       420
     caaaaagaga ttaatgcaga aacccatggc agcgatcagg ttaattcgca aagcagcatg       480
     agccgggcat caacgtcaca gccgttggtg ggacagggaa agagcgaatg ggataattac       540
     catgcaagat tacggcagga aatcgagcac cacaaagagt atccccgcaa ggcaaaaaga       600
     atgaaacagc aaggtatcgt tatcataaac tttaccctgc tgaatgacgg tacattaacc       660
     gcagccaaag tggttaattc ctccggtaac agcacattgg acaatgccgc cctcaatgcc       720
     atccatcgcg cccgttcggt gggcgtcaaa cccgcggata tcccgtccga tgtcacgctc       780
     cggcttgatt ttaagttgga ttga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page