(data stored in ACNUC1104 zone)

EMBL: FN667742.PE70

FN667742.PE70        Location/Qualifiers
FT   CDS_pept        complement(79023..79763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0013"
FT                   /locus_tag="XNC1_0075"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88163"
FT                   /db_xref="InterPro:IPR001677"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88163.1"
FT                   /translation="MKKFNVLVAALGALGFMAQAQAAVGFGQSQDETTPHIKVGATQPG
FT                   SGPHGGKGGEPGIGVSSVYGGQITGFAGLTRMAPADSNGIHNISMAGAPGSHGGMGVFH
FT                   FSKVANADVYFGEWSQTGQASDSTHTVYYAGKDVTTNIPTDGTATYTVTGINQYSGDNA
FT                   LSGTFTADFGEKTLAGSLANTAMTIDIDASIGADAKFEGAAITDTLVGQTNGHFFGDSA
FT                   ASLAGYATFADDSTKDTAFGGSKQ"
     atgaaaaagt tcaacgtatt agttgccgct ttaggggcat tgggatttat ggcacaggct        60
     caggcagcag taggatttgg tcagagccaa gatgaaacaa cgccacacat taaggttggt       120
     gcaacccaac cgggttcagg cccacacggt ggcaaaggtg gcgaacccgg cattggtgtc       180
     agttccgttt atggtggtca gatcactggc tttgccggct tgactcgcat ggcacctgct       240
     gacagcaatg gtatccataa catctcaatg gcaggagcac ccggctctca cggtggtatg       300
     ggcgtattcc atttcagcaa agttgccaat gcagatgttt acttcggtga atggtctcag       360
     acaggtcagg catcggatag cacccacacg gtttattatg caggcaagga cgtcactacc       420
     aatatcccaa cagacggtac agcgacttac accgtgacgg gtattaacca atacagtggc       480
     gacaatgccc tgtccggcac atttaccgca gattttggtg aaaaaacgct ggctggttca       540
     ctggcaaata ctgcgatgac gatagacatt gatgccagta tcggcgctga tgccaaattt       600
     gaaggtgctg ccataacgga tactttggtt gggcaaacca acggccactt ctttggtgac       660
     agtgctgcca gcttggctgg atatgccaca tttgctgatg acagtaccaa ggataccgca       720
     ttcggtggtt ctaaacagta a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page