(data stored in ACNUC1104 zone)

EMBL: FN667742.PE76

FN667742.PE76        Location/Qualifiers
FT   CDS_pept        82739..83017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0014"
FT                   /locus_tag="XNC1_0081"
FT                   /product="CcdA protein"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 15774890; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88169"
FT                   /db_xref="InterPro:IPR009956"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88169.1"
FT                   /translation="MTRVLTRVICGDYMTALHSRTKKTVSVTVSPELYEQAKQIGLNFS
FT                   AILTQALIAELKSAAAEQWKRDNREGFEELNRITREHGLLSDQYRTF"
     atgacacgtg tgcttacacg tgtcatttgc ggggattata tgacagcatt acactccaga        60
     actaaaaaaa ccgtcagcgt gactgtttca ccagaactgt atgaacaagc aaaacaaata       120
     ggactaaatt tttctgctat tttgactcag gcattaattg cagaacttaa atctgcggcg       180
     gctgagcagt ggaaacgtga taatagggag ggattcgaag aactcaatcg catcacccgt       240
     gaacatggtc tactgtccga tcaatatagg acattttaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page