(data stored in ACNUC1104 zone)

EMBL: FN667742.PE78

FN667742.PE78        Location/Qualifiers
FT   CDS_pept        83293..83430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0014"
FT                   /locus_tag="XNC1_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88171"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88171.1"
FT                   /translation="MRWIYSLTGFEQAGPRSHPIELNREVENETGGGAFPPVLQDVMGF
FT                   "
     atgcgatgga tttactcttt gacgggtttt gaacaagcgg gaccgcggtc ccaccctatc        60
     gaactgaatc gtgaagttga aaatgaaacc ggaggcggtg cttttcctcc ggttttgcag       120
     gatgttatgg ggttttag                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page