(data stored in ACNUC1104 zone)

EMBL: FN667742.PE79

FN667742.PE79        Location/Qualifiers
FT   CDS_pept        complement(83427..85505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0015"
FT                   /locus_tag="XNC1_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88172"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88172.1"
FT                   /translation="MKLTPEKLFTAINEYAHQPEKKRYLTPKQVQWFADPENVFLLIAI
FT                   VLTIPEEVMDKIGDSISNWVEAAIAELALTATKLPVGVKRQFEGAIEETLNHAKENFAL
FT                   NSECVLLLLSILKKNQFNIQTDITQLLEISEHDDNAGVVSFPTQPIRLSQLLDQYDIQS
FT                   GIEFIEFFENGVSVVPHEALPHLLSELSKYSWGIDALLLLTQYFEEPVALASGQVLDSC
FT                   PSSAWANLSYQQLINLCARFNRHPSVKHSMKRWKKLAMKHCHARATAKIHELYVSHVDG
FT                   NDCASIMMKATLNGEDDQLSMMLDFKSGIRETFLDIDPNKSLTELIAQLDDSVDFTPVS
FT                   PEWLQQILPWILSVQHSKNTPLDLYSLYWLSQLPAEWTEPEEFEFENWNQKLSYQADFQ
FT                   RKERNRLSSIYMKHFSPLLMTWLAPEECLLEAKKPRDLLKNYYYANRDLFTERLTYSAA
FT                   VERYKLPPSAQRFANDYLDLAHSLHDPALNRKKFSLFDALSEMSFEFFAMMLDPVNAEL
FT                   PLQGLVIKVSLLDASPAVWRRISVSNQLTLCELHDVIQDAMGWENAHLYCFDIGGIEIP
FT                   EEHYDQVRIGIFLNDIGSTLNYQYDFGDDWSHQVTVEKLLPKDIIQPEVTAGNGMCPAE
FT                   DSGGIWHWNHLLKLRKKKILTEEEAEQLEWAGLSPDEQPEPFDKQLANKRLKALFNY"
     atgaaactca cacctgaaaa attatttact gcaattaatg aatatgccca ccaacctgaa        60
     aaaaaacgat atttaacacc caaacaggtt caatggtttg ccgatccaga aaacgttttc       120
     ttgctgatag ccatcgtgtt aaccatacct gaagaggtta tggataagat aggcgacagc       180
     atcagtaact gggttgaagc agctatcgcg gaactggcac tgaccgccac taaattgcca       240
     gtgggagtca aacgacaatt tgaaggagct atcgaagaaa ccctgaacca tgccaaagaa       300
     aatttcgcac tcaatagtga atgtgtgttg ctactgttat caatcctgaa gaaaaatcag       360
     tttaatatcc agactgacat tactcagtta ctggaaatat ccgaacatga tgacaacgca       420
     ggtgtagtca gctttcccac ccagcccatc agattaagcc agttgcttga tcagtatgat       480
     attcagtccg gcattgaatt cattgagttt tttgaaaacg gcgtttcagt tgtccctcat       540
     gaggctttac ctcatttatt gtcagaactg tccaagtatt catggggcat agatgccctg       600
     ctcctgttaa cccaatactt tgaagagccg gtggcactgg ccagtgggca agtgttggat       660
     agttgtcctt cctcagcctg ggcaaattta tcctaccaac agcttatcaa cctgtgtgcc       720
     cgttttaacc gccacccttc ggttaaacac tccatgaaac gctggaaaaa actggcaatg       780
     aagcactgtc atgcccgggc aacagcaaaa atacatgaat tatatgtttc ccatgtggat       840
     ggcaatgatt gtgccagcat aatgatgaaa gccacgctga acggtgaaga cgaccaatta       900
     agcatgatgc tggattttaa atcgggcatc agggaaactt tcctggatat tgatcccaat       960
     aaatcactca ctgaactgat agcacaatta gatgacagtg ttgacttcac tcccgtttct      1020
     ccggaatggc tgcaacaaat cctgccgtgg atactttccg ttcagcacag taaaaatacg      1080
     ccgctcgacc tctattctct ttattggtta tcgcagttac ctgccgaatg gacagaacca      1140
     gaagaatttg aatttgagaa ctggaaccaa aagcttagct atcaggcaga ttttcaacgc      1200
     aaagaacgga atcgcctcag ctccatctac atgaagcatt tttcgccatt gctgatgact      1260
     tggctggcac cggaagagtg tttgttggaa gcgaaaaaac ccagagacct cttgaaaaac      1320
     tattactatg caaaccggga tctgtttact gagcgcctga cttattcagc cgcagtagaa      1380
     cgatataaac tgccgccaag cgctcagcgt ttcgcaaatg actacttgga tttagcgcat      1440
     tcgctccacg atccggcatt gaaccgcaag aaattttcgc tgtttgatgc gttatcagaa      1500
     atgagttttg agttttttgc catgatgctg gaccccgtca atgccgagct tccactgcaa      1560
     gggttagtca tcaaagtaag cttacttgat gcaagtcctg cggtatggcg tcggatcagt      1620
     gtcagtaacc aactgacatt gtgcgaactc catgatgtga tacaagatgc catgggttgg      1680
     gaaaatgccc acctgtactg ttttgatatc gggggaatag aaatcccgga agaacattat      1740
     gaccaggttc gtatcggcat cttcctgaat gatattggca gcacacttaa ttatcagtat      1800
     gactttggtg atgactggtc ccatcaggta accgtcgaga aacttcttcc gaaggatatt      1860
     atccagcccg aagtgaccgc aggcaatggc atgtgtccgg ctgaagattc cggtggtatc      1920
     tggcattgga atcacctgct caaattgagg aaaaagaaaa tcctgacaga agaggaagca      1980
     gaacaattag agtgggcagg tttgtctccg gatgaacagc ctgaaccttt tgataaacaa      2040
     ctggctaaca agagactgaa ggcactgttt aattactaa                             2079
//

If you have problems or comments...

PBIL Back to PBIL home page