(data stored in ACNUC1104 zone)

EMBL: FN667742.PE8

FN667742.PE8         Location/Qualifiers
FT   CDS_pept        complement(9131..9271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0002"
FT                   /locus_tag="XNC1_0008"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88101"
FT                   /db_xref="GOA:D3VG11"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88101.1"
FT                   /translation="MQVLSSLKTAKQRHPDCKVVRRRGRLYVICKSNPRFKAVQGKKKK
FT                   R"
     atgcaggtac tgagttcatt aaaaacagca aagcagcgcc atcctgattg caaggttgtt        60
     cgtcgtcgtg gccggctata tgttatttgt aaatccaatc cacgttttaa ggccgttcag       120
     ggcaagaaaa agaaacgctg a                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page