(data stored in ACNUC1104 zone)

EMBL: FN667742.PE85

FN667742.PE85        Location/Qualifiers
FT   CDS_pept        89999..90265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0017"
FT                   /locus_tag="XNC1_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88178"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88178.1"
FT                   /translation="MTPALARYGGLNVRLSCWFEETETLLALSWANQVGKLCSGHGVIF
FT                   YGTPKRVRFFCADPGKENRRSYDQSHFQDAIHYPHSLLSRGLS"
     atgacaccgg cccttgcgag gtatggtggt ttaaacgtcc ggctgtcatg ttggtttgaa        60
     gaaacagaga ctttattggc tttatcatgg gctaatcaag tcggtaagtt atgctctggt       120
     catggtgtca ttttttatgg gactccaaaa cgtgtgcgat ttttttgtgc cgacccaggg       180
     aaagagaacc gtaggagcta tgaccagagc cactttcagg acgctatcca ttatccacat       240
     tccctactga gtcgtggctt aagttag                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page