(data stored in ACNUC1104 zone)

EMBL: FN667742.PE86

FN667742.PE86        Location/Qualifiers
FT   CDS_pept        90355..91812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0017"
FT                   /locus_tag="XNC1_0091"
FT                   /product="Cytosine/purines, uracil, thiamine, allantoin
FT                   permease family protein (modular protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88179"
FT                   /db_xref="GOA:D3VG89"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88179.1"
FT                   /translation="MSTQQNRHRFWKVERTGIDLVPASERTGTPLDLFWVWSAANIGIL
FT                   GIVYGAIIVSFKLSFLQSVLAALIGLSSFALVGYVSFSGKRGRTTTLTLSRTIFGIKGN
FT                   TAPTVIFWFISMGWESINIVTGTLTLSALFQACGLAESTLLTVASMILFAGLSIGVTLL
FT                   GKEMVITLQRWVIQIFGIMTLVVVFYILMMTKWETVLSMPPGSWLTGFLPAVSVVAAGS
FT                   GIAWAASSADYSRFQNENSSNAKIFTAVTAGGMIPLVLLLFAGILLSVQLPDLPNSDNP
FT                   IAHIGSILPDWMLIPYLMTALAGIVIMAVMSLYSASLNLLTLGIKVKRIHAVTIDSVIV
FT                   LTVAVYTLFVTGDFMGPFIAFLIFFGVFLAAWEAVFLLDYIVIRRKQGYCPDTLFNDSG
FT                   PNGGIKWVPISCWLLGALAGFMVTKNDFMSGPWAVGIFANSSFGLFLSFFVSLICYGLY
FT                   LMLNRDKRLKHLYCLSLSWDRRQGILF"
     atgagtacac agcaaaatcg tcatcggttc tggaaggtgg aacgcacagg tatagatctt        60
     gttcctgctt cagaacgtac aggtacacca ctggatttat tttgggtctg gtctgccgct       120
     aatattggta tcctcggcat tgtttacggt gccatcattg tctcctttaa actttctttt       180
     ttacagtcag tgcttgctgc attgatcggc ctttccagtt ttgcattggt gggctatgtc       240
     agtttcagtg gcaaacgggg aagaacaacg acgctgactc tctcccgcac aatttttggt       300
     atcaaaggaa atacggctcc gacagtcatc ttctggttca tttccatggg atgggagtcc       360
     atcaatattg tcacggggac attgacgctg tcagcgttat ttcaggcttg cggactggct       420
     gaaagtacac tgttgacggt agccagcatg atattattcg cagggttgtc aattggtgtc       480
     acgctgctgg gaaaagaaat ggttattacc ctgcagcgat gggttatcca gatttttggc       540
     attatgacat tggttgtggt gttttatatt ctgatgatga caaaatggga aacggtgttg       600
     tccatgccgc cagggagttg gttaaccgga tttttgccgg cggtttcggt cgttgctgcg       660
     ggaagtggca tagcctgggc ggcttcgagc gctgattata gccgttttca gaatgaaaat       720
     tcgtccaacg ccaagatttt caccgcagtc accgcaggcg gtatgatccc tctggtattg       780
     ctgttattcg cgggaatttt gctctcagtt caattacctg acctgccgaa ctcagataat       840
     ccgattgccc atattggttc catcctgccg gattggatgc tgatccctta tttgatgact       900
     gcccttgccg gtatcgtcat tatggcggtc atgagcctct attctgccag cttgaattta       960
     ttgacattgg gtataaaagt taagcgaatt catgctgtta ctattgattc tgttattgtg      1020
     ctgactgtcg cagtttatac cctgtttgtt accggtgact ttatggggcc atttatcgca      1080
     ttcctgatat ttttcggagt gtttttggcc gcttgggagg cggtattctt gcttgactat      1140
     atcgtgatcc gccgtaagca ggggtattgc ccggatacat tattcaatga cagtggcccg      1200
     aacggtggca ttaaatgggt tccgatatcg tgttggttac tgggagcatt ggctggtttt      1260
     atggtgacaa aaaatgattt catgagtggc ccgtgggcag tcgggatttt tgcgaattcc      1320
     agctttgggc tgtttttgtc atttttcgtc agtcttatct gttatggtct gtatttgatg      1380
     ttgaataggg ataaaagatt aaagcacctt tactgcctgt cgttgtcgtg ggatcggcga      1440
     caggggatat tgttctga                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page