(data stored in ACNUC1104 zone)

EMBL: FN667742.PE88

FN667742.PE88        Location/Qualifiers
FT   CDS_pept        92814..93137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88181"
FT                   /db_xref="GOA:D3VG91"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88181.1"
FT                   /translation="MRKITSFSMGEQLDGFVQRMIESGRYGSTSEVMRSALRLLEQQEN
FT                   QDEAIRNAVIDGLNSGKSSLTLRDIAEQRKRQRISKPLTVLPISPDTNPDIFNIHLHQI
FT                   ASV"
     atgagaaaga ttacttcttt cagtatgggt gaacagcttg acggttttgt gcagcgaatg        60
     attgaaagtg gtcgttatgg ttcaaccagt gaagttatgc gctctgcact gcgtttactg       120
     gagcaacagg aaaaccagga cgaagctatt cgtaacgcag ttattgatgg tctgaacagt       180
     ggaaaaagtt cactaaccct gcgagatatc gctgaacaaa ggaagcgcca gcggatatcg       240
     aaaccgctta cggttttacc catatcccct gacactaatc ccgatatatt caatattcat       300
     ctgcaccaaa tcgcatctgt ctga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page