(data stored in ACNUC1104 zone)

EMBL: FN667742.PE90

FN667742.PE90        Location/Qualifiers
FT   CDS_pept        93927..95336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0095"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88183"
FT                   /db_xref="GOA:D3VG93"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88183.1"
FT                   /translation="MIMTEEGRWRDLFSGKNASSAIVLSLGVGLMAVNTLIAITILPSI
FT                   VRDIGGLNLYAWNTTLFVIASIIGSILSARLLSTSGARNAYLVASLIFFVGSLICTLAP
FT                   SMGIMLIGRTVQGFGGGFLFALSYSMIHLVFEQALWSRAMALISGVWGIATLIGPAIGG
FT                   IFAEMNAWRYAFGTMVPVLLLYALFSYLILPKRVQSTTKTALPIIQLILLSVAVLAVSS
FT                   GSLSQDVRVNIIGIFIAVVLVFILIIYERRTSARLMPKNTFSLHSPHLILFATIFLLTV
FT                   GLSGDVFIPYFLQMLHGQSPLISGYMVAIAALGWSAGEMLSAGWQGAKMRFAVVSGPVF
FT                   MLAGMLFLFVILPYPSAGEWQIVLPIMLGLGLFGFGVGLGWPHLLTRLLQVSSEADKSI
FT                   AGSSITTIQLFSTAFGSALGGMIVNIFGFYEPGGKEGAAVSSYWLFLIFAIAPVLAFLT
FT                   AYKSAKIKVEK"
     atgataatga cagaggaagg ccgctggagg gatctgtttt ccggcaaaaa tgcgtcgagt        60
     gccatagtac tttcactcgg cgtgggattg atggcagtta atactttaat cgcgattact       120
     attttaccct cgattgtaag agatatcggc gggttgaacc tttatgcctg gaatacgaca       180
     ttgtttgtca tagcatccat tattggttct atcctttccg cgagattact cagtacgtcg       240
     ggcgcaagga atgcatattt ggttgcgtca ttgatctttt ttgtcgggag tttaatttgt       300
     actttggccc cttcgatggg gattatgttg ataggaagaa ctgttcaggg attcggaggg       360
     ggatttctgt tcgcactttc ctattcgatg attcatctgg tttttgagca agctctctgg       420
     agccgtgcca tggcgctgat ttcgggcgtc tggggcatag cgacgttaat cgggccggcg       480
     atcggtggta tttttgctga aatgaatgcc tggcgttatg cgtttggcac tatggtgcct       540
     gttctcctgc tgtatgcctt gttcagctat ctgattttgc ctaaacgagt acaaagtacc       600
     accaaaacag cgttaccgat tatacagctg attttgttat cggttgcggt actggcggtc       660
     tcctcaggca gtttgtcaca agatgtacgg gttaatatta ttggcatttt tattgccgtg       720
     gtattggtat tcatcttgat tatctatgaa cgtcgcactt cggcgagatt gatgcccaaa       780
     aatacgttca gcctgcactc tcctcatctg attttatttg ccaccatttt tctgttgacg       840
     gtaggtttat cgggcgatgt ttttatcccc tattttctgc aaatgctgca tgggcaatct       900
     ccgctgattt ccggctacat ggttgctatc gcggcacttg gatggtctgc gggggaaatg       960
     ttgagtgctg gctggcaagg cgcaaaaatg cggtttgcgg ttgtaagcgg ccctgtcttt      1020
     atgctggcgg gtatgctgtt cttgtttgtg atactgccat atccgtcagc aggtgagtgg      1080
     caaatagtct tgccgatcat gctgggattg ggattgtttg gttttggggt aggtttgggt      1140
     tggcctcatc ttctgacgcg ccttttgcag gtttccagtg aggctgataa aagcattgct      1200
     ggttcatcca ttacgaccat tcagctattt tccactgcat ttggttctgc attgggaggg      1260
     atgatcgtca atatcttcgg gttttatgaa cctggtggca aggaaggtgc ggcagtatct      1320
     tcctattggc tatttttgat cttcgccatt gcacctgtat tggcattctt gaccgcgtat      1380
     aaatccgcaa aaattaaagt ggaaaaataa                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page