(data stored in ACNUC1104 zone)

EMBL: FN667742.PYRI

FN667742.PYRI        Location/Qualifiers
FT   CDS_pept        complement(457949..458413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0099"
FT                   /gene="pyrI"
FT                   /locus_tag="XNC1_0524"
FT                   /product="aspartate carbamoyltransferase, regulatory
FT                   subunit (allosteric regulation)"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0524"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88598"
FT                   /db_xref="GOA:D3VIP8"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIP8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88598.1"
FT                   /translation="MTQDHQLQVEAIKCGTVIDHIPAHIGFKLLSLFKLTETDQRITIG
FT                   LNLPSNHLGKKDLIKIENTFLTEQQANQLALYAPQATINNIENYVVVKKMPINLPEQID
FT                   SVLVCPNSNCISHNEPVNSSFHVKTAENDVVLRCKYCEKEFDRQAVINND"
     atgactcaag accatcaatt acaagtagaa gccattaaat gtggcacggt tatcgatcac        60
     attccggctc atatcggctt taagttattg tcactgttca aactgactga aaccgatcag       120
     cgcatcacca tcggtctgaa cttgccttcc aaccatctgg gtaaaaagga tctgatcaag       180
     attgaaaata ccttcctgac agagcagcag gcaaaccaac ttgctctgta tgcaccacag       240
     gccacgatca ataatattga aaactatgtt gtggttaaaa agatgcctat caatttacct       300
     gagcaaattg acagtgtgct ggtctgccca aacagcaatt gcatcagtca caatgaaccg       360
     gtcaacagca gctttcatgt caaaaccgct gaaaatgatg tggtattgcg ttgtaagtac       420
     tgtgaaaaag agtttgaccg tcaggctgtt atcaataacg attga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page