(data stored in ACNUC1104 zone)

EMBL: FN667742.RFFC

FN667742.RFFC        Location/Qualifiers
FT   CDS_pept        325299..326024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0071"
FT                   /gene="rffC"
FT                   /locus_tag="XNC1_0390"
FT                   /product="putative acyl-CoA N-acyltransferase,
FT                   lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88467"
FT                   /db_xref="GOA:D3VHX8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012752"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHX8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88467.1"
FT                   /translation="MSIHANLEPLAWDSQFFGLSTARLNLSPGAAVITAAHLDEYALVQ
FT                   AKIPAQQTAVLDALSALSFSLAEGEADLLLSLDAGDQTEIQTGQNAVPKFVIAKPQDIP
FT                   ALKAVAEQVFKVSRFRAPWYQPDDSGRFYAVWVENAVLGTFDHECLMINDEHGQMMGFV
FT                   TLRDIGSHEARIGLLATVPGSHHQGIGKKLMSAAQQWCQQHQIQRLRIATQISNIAALR
FT                   LYTRRGAIIESTAYWLYRG"
     atgtctattc acgccaatct tgaaccgctg gcctgggata gccagttttt tggtttatcc        60
     accgcccgtc tgaatttatc accgggagcg gctgtgataa cagcggctca tctggatgaa       120
     tacgccttgg tgcaggcaaa gattcctgcc cagcaaacag cggttcttga tgcgttgtct       180
     gccttgagtt tttctctggc ggaaggtgag gctgatttac tgttatcgct tgatgccgga       240
     gatcagacag agattcaaac cgggcaaaat gcggtgccaa aattcgttat tgcaaaacca       300
     caggatatac ctgcattgaa agccgttgca gaacaggtgt tcaaggtcag ccgcttccgt       360
     gcaccgtggt atcagccgga tgacagtgga cgattctatg cggtttgggt tgaaaatgca       420
     gttttgggca cgtttgacca cgaatgcctg atgattaacg atgaacacgg tcagatgatg       480
     ggatttgtca ccttaagaga tatcgggagc catgaagccc ggattggttt actggctacg       540
     gtacccggca gtcaccatca gggaattgga aaaaaattga tgtcggcggc gcagcagtgg       600
     tgccagcagc accagattca gcgactgaga atagcaacac aaatcagtaa catcgctgct       660
     ttgcgtcttt atacacgtcg tggtgccatc attgagagca ctgcatattg gttatacaga       720
     gggtga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page