(data stored in ACNUC1104 zone)

EMBL: FN667742.RFFE

FN667742.RFFE        Location/Qualifiers
FT   CDS_pept        111780..112907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0022"
FT                   /gene="rffE"
FT                   /locus_tag="XNC1_0116"
FT                   /product="UDP-N-acetyl glucosamine-2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88204"
FT                   /db_xref="GOA:D3VGB4"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88204.1"
FT                   /translation="MKILLVFGTRPEAIKMASLIYELKKHSNFNVRVCVTGQHRDMLDQ
FT                   VLNLFNIIPDIDLNIMESSQDLTSITCNILTKLKHVIFEEKPDLVLVHGDTTTTFAASL
FT                   SAFYHKVKVGHIEAGLRTGNIDSPWPEEANRKLVSSLACLHFTPTATARNNLISENINS
FT                   DTIFVTGNTVIDSLLEMKSIIGKNINLQTRFDYEFSFINKYKKSILITGHRRENFGQGF
FT                   QNICHAIKLLAQKNQDVCFIYPVHLNPNVKNVVEKTLYGQNNIYLISPQTYDSFVYLMS
FT                   RAYIILTDSGGIQEEAPSLGKPVLVMRNSTERPEAISAGTVKLVGTSTDEIYSSVTKLL
FT                   NNANLYLEMSKSCNPYGDGKASKYIAKILLKNFIN"
     atgaaaattt tactagtttt tggcactcgc cctgaagcaa taaaaatggc ttcgcttatt        60
     tatgaattaa aaaaacattc gaattttaat gtgcgtgtat gtgtaacagg gcaacaccgt       120
     gatatgctag atcaagtttt aaatttattt aatataatac ctgatataga tttaaatatc       180
     atggaatcaa gtcaagatct aacatcaata acatgtaata tcttaaccaa attaaaacat       240
     gttattttcg aagaaaaacc tgatttagta cttgtacatg gtgatacaac cacaacattt       300
     gcagctagct taagtgcatt ttatcataaa gtcaaagtag gacacatcga agctggattg       360
     agaactggca atatagattc tccatggcca gaagaagcaa atagaaaact agtttcttca       420
     ttagcttgtc ttcattttac accaaccgca acagcaagaa ataacttaat atcagagaat       480
     attaattctg ataccatttt tgttactggt aatacagtaa ttgattctct tttagagatg       540
     aaaagtataa taggaaaaaa cattaatcta caaactagat ttgattatga atttagtttt       600
     ataaacaaat ataaaaaaag cattttaatt acgggacata gaagagagaa ctttggccaa       660
     ggttttcaaa atatatgtca tgcaattaag ctactcgcac aaaaaaatca agatgtatgt       720
     tttatatatc cagtccatct aaatcctaat gtaaaaaatg ttgtagaaaa aactctttat       780
     ggacaaaata atatttactt aatttcacca cagacatatg attcatttgt atatttaatg       840
     agcagagcat atattatctt aacagattct ggtggtatac aagaagaagc accatcacta       900
     ggaaaacctg tgttagtaat gagaaactct accgaaagac cagaagcaat atctgctgga       960
     actgttaaat tggtaggtac atcaactgat gaaatctata gctccgtgac taagctatta      1020
     aataatgcta atttatattt agaaatgagt aaatcttgca atccatatgg ggacggcaaa      1080
     gcatctaaat atattgccaa aatactgctt aaaaacttca tcaactaa                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page