(data stored in ACNUC1104 zone)

EMBL: FN667742.RFFM

FN667742.RFFM        Location/Qualifiers
FT   CDS_pept        330922..331659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0072"
FT                   /gene="rffM"
FT                   /locus_tag="XNC1_0396"
FT                   /product="putative UDP-N-acetyl-D-mannosaminuronic acid
FT                   transferase, with FMN-linked oxidoreductase domain"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88473"
FT                   /db_xref="GOA:D3VHY4"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR023085"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHY4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88473.1"
FT                   /translation="MGLNNIPKYRIRGLNIWGFRGMSHFLDHLFQGGRVQTGTLVAINA
FT                   EKVLTAEQDNALNMLLNEAEYLYADGISIVRAIRRKYPDADVSRIAGADLWEALMERAG
FT                   REGTPVFLVGGKPAILVQTENKLRTQWNVNIVGSQDGYFTPETRDAVFERIRASGAAII
FT                   TVAMGSPKQEIFMRDCRKVYPDALYMGIGGTYDVFTGHIKRAPKVWQNLGLEWLYRLLS
FT                   QPSRIRRQIKLLRFLGYYYSGKL"
     atggggttga ataacattcc taaatatcgc attcgtggtc tcaatatctg gggatttcgc        60
     ggtatgtcgc atttccttga tcatcttttt cagggcgggc gggtacaaac cggtacgttg       120
     gtcgcgatta acgcagaaaa agtgctcacg gcagaacaag ataatgcact gaatatgttg       180
     ctgaatgagg ctgaatactt atatgcggat ggtattagca ttgtgcgtgc cattcgccgt       240
     aaatatcctg atgctgatgt atcgcgtatt gccggggcag acttgtggga agccttgatg       300
     gaacgggctg gtcgcgaagg aacgccggtc tttctggtgg gtggaaaacc ggcaattctg       360
     gttcagacag aaaacaaatt acgtactcag tggaacgtca atattgtagg cagtcaggac       420
     ggttatttta cgccggaaac gcgtgacgca gtatttgagc gcattcgtgc cagcggtgcg       480
     gcgattatta ccgtggcgat gggatcccct aaacaggaaa tcttcatgcg tgattgccgc       540
     aaggtatatc ccgacgcact ttatatgggg atcggtggga cgtatgacgt ttttacgggg       600
     catatcaaac gtgcgccaaa agtttggcag aacttgggtt tggagtggct ctaccgtttg       660
     ctttcccagc cgagccgtat ccgtaggcag attaaattat taagattcct cggctattac       720
     tacagtggca agctttag                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page