(data stored in ACNUC1104 zone)

EMBL: FN667742.RHLB

FN667742.RHLB        Location/Qualifiers
FT   CDS_pept        complement(314684..315967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0070"
FT                   /gene="rhlB"
FT                   /locus_tag="XNC1_0380"
FT                   /product="putative ATP-dependent helicase with nucleoside
FT                   triP hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88457"
FT                   /db_xref="GOA:D3VHW8"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHW8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88457.1"
FT                   /translation="MSKTHLTEKKFSDFALHPKVLGALDKKGFSNCTPIQALTLPFTVE
FT                   GRDVAGQAQTGTGKTLAFLASTFHYLLTHPAGKERKINQPRALIMAPTRELAVQIYSDA
FT                   KELAEVTGLKMGLAYGGDGYDKQLKVLESGVDIVIGTTGRLIDYAKQGHIHLGAIQVVV
FT                   LDEADRMYDLGFIKDIRWLFRRIPAATERLNLLFSATLSYRVRELAFEQMNNPEYVEVE
FT                   PLQKTGHRIREELFYPSNEEKMRLLQTLLEEEWPDRCIIFANTKHRCEDIWTHLAADGH
FT                   RVGLLTGDVAQKKRLRILEEFSLGNLDILVATDVAARGLHIPSVTHVFNYDLPDDCEDY
FT                   VHRIGRTGRAGESGHSISLACEEYVLNLPSIEEYIQHQIPVSKYNSDALLKDLPVPKRR
FT                   NRTRPGGHPRRINMPRRGNPTRNRKHPS"
     atgagcaaaa cacatttgac agaaaagaag ttttccgact tcgcattgca ccccaaagtc        60
     ctaggagccc ttgataaaaa agggttttcc aactgcacgc ctatacaggc gctaacattg       120
     ccttttactg tcgaaggccg agatgttgcg gggcaagcac aaaccggaac aggcaagacg       180
     ctggcatttt tggcgtctac ttttcattac ttattaactc atcctgcggg gaaagagcgt       240
     aaaattaatc agccaagagc actgattatg gctccaaccc gtgaattagc tgtccaaata       300
     tattctgacg caaaagaact ggcggaagtc actggattga aaatgggtct tgcctacggt       360
     ggcgatggct atgataaaca gcttaaggtg ctggaatcag gtgttgatat cgttattggc       420
     acaacaggtc gtttgatcga ttatgcaaaa caaggccata ttcatcttgg tgcgattcaa       480
     gttgtcgtac ttgatgaagc tgatcgcatg tacgatttag gctttatcaa agacattcgc       540
     tggctgttcc gccgtatccc ggcagcaaca gaaagactga atttgctttt ttctgcgacg       600
     ctgtcttacc gggtgcgcga actcgctttc gaacagatga ataaccctga atatgtggaa       660
     gttgaaccct tgcagaaaac agggcaccga attcgtgaag agctatttta tccttccaat       720
     gaagaaaaaa tgcgtctgtt acagaccttg ctggaagaag aatggccgga tcgttgcatc       780
     atttttgcca ataccaagca ccgctgtgaa gatatctgga ctcatctggc tgccgatggt       840
     catcgcgttg ggcttctgac tggcgatgtt gcccagaaaa agcgactgcg tattctcgaa       900
     gaattcagtc tgggtaatct ggatattttg gttgcgaccg atgtggctgc ccgtggtctg       960
     catattccat ctgtgacgca tgtatttaat tatgatctac cggatgactg tgaagattat      1020
     gttcaccgga ttggccggac aggacgcgcc ggagaaagcg gtcactctat cagtctggca      1080
     tgcgaagaat atgtgttgaa cttaccttct attgaagagt atatccagca ccagataccc      1140
     gtcagtaaat ataatagtga tgcgttatta aaagatttac ccgttcctaa gcgccgtaat      1200
     cgtacacgtc cagggggaca cccacgccgt ataaatatgc cacgtcgtgg aaatccaaca      1260
     cgcaaccgta aacacccaag ctga                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page