(data stored in ACNUC1104 zone)

EMBL: FN667742.RPLN

FN667742.RPLN        Location/Qualifiers
FT   CDS_pept        271916..272287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplN"
FT                   /locus_tag="XNC1_0328"
FT                   /product="50S ribosomal subunit protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88410"
FT                   /db_xref="GOA:D3VHS1"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHS1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88410.1"
FT                   /translation="MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAHVGDIIKITIKE
FT                   AIPRGKVKKGDVLKAVVVRTKKGVRRPDGSVIRFDSNACVLLNNNSEQVIGTRIFGPVT
FT                   RELRNEKFMKIISLAPEVL"
     atgatccaag aacagactat gctgaacgtg gccgacaact ccggtgcacg tcgcgtaatg        60
     tgtatcaagg ttctaggtgg ctcgcaccgt cgctacgcac atgtcggtga cattatcaaa       120
     atcacaatca aggaagcaat tcctcgtggt aaagtgaaaa aaggtgatgt cctgaaagcg       180
     gtagtggtgc gcaccaagaa gggtgttcgt cgcccggacg gttctgtcat tcgcttcgat       240
     agcaacgctt gtgtattgtt gaacaacaat agtgagcaag ttatcggtac gcgtattttt       300
     gggccggtaa ctcgtgaact tcgtaatgaa aagttcatga aaattatctc tctggcacct       360
     gaagtactct aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page