(data stored in ACNUC1104 zone)

EMBL: FN667742.RPLO

FN667742.RPLO        Location/Qualifiers
FT   CDS_pept        275524..275958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplO"
FT                   /locus_tag="XNC1_0337"
FT                   /product="50S ribosomal subunit protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88419"
FT                   /db_xref="GOA:D3VHT0"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHT0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88419.1"
FT                   /translation="MRLNTLSPAEGAKHASKRVGRGIGSGLGKTGGRGHKGQKSRSGGG
FT                   VRRGFEGGQMPLYRRLPKFGFTSRKAMITAEIRLSDFAHVEGDVIDLNALKAANIIGPQ
FT                   IEFAKVMLSGEVNRAVTVRGLRVTKGARAAIEAAGGKIEE"
     atgcgcttaa atactctgtc tccggctgaa ggtgccaagc acgcatctaa acgtgtaggt        60
     cgtggtatcg gttctggcct aggtaaaact ggcggacgtg gtcacaaagg tcagaaatct       120
     cgttctggcg gtggcgttcg tcgcggtttt gaaggtggtc agatgccttt atatcgtcgt       180
     ttgccgaaat ttggttttac ttcacgtaaa gcaatgatca ctgcagaaat tcgtctgtct       240
     gattttgctc atgttgaagg cgatgttatc gatctgaatg cattgaaagc tgctaacatt       300
     attggccctc aaattgaatt cgctaaagta atgctttctg gcgaagtcaa tcgtgcagta       360
     actgtgcgtg gcttgcgtgt tactaaaggc gcccgtgctg cgattgaagc tgctggcggt       420
     aaaattgagg aataa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page