(data stored in ACNUC1104 zone)

EMBL: FN667742.RPLP

FN667742.RPLP        Location/Qualifiers
FT   CDS_pept        270918..271295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplP"
FT                   /locus_tag="XNC1_0325"
FT                   /product="50S ribosomal subunit protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88407"
FT                   /db_xref="GOA:D3VHR8"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHR8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88407.1"
FT                   /translation="MHKGRNRVLAAGAEVSFGTFGLKAVGRGRLTARQIEAARRAMTRA
FT                   IKRQGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYEMDGVPEELARE
FT                   AFKLAAAKLPIKTTFVTKTVM"
     gtgcataaag gccgcaaccg tgttctggct gccggtgcgg aagttagctt cggcactttc        60
     ggtctaaaag ctgtgggccg cggtcgtctg accgctcgtc agattgaagc ggcacgtcgt       120
     gctatgaccc gtgcaattaa gcgtcaaggt aaaatctgga tccgtgtgtt cccagacaaa       180
     ccgatcactg aaaagccact cgaagtgcgt atgggtaaag gtaaaggtaa cgtagaatac       240
     tgggttgcct tgatccagcc cggtaaagtc ctgtatgaaa tggacggtgt gcctgaagag       300
     ctggctcgtg aagcattcaa gctggcagca gcgaaactgc ctatcaaaac cacctttgta       360
     actaagacgg tgatgtaa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page