(data stored in ACNUC1104 zone)

EMBL: FN667742.RPLR

FN667742.RPLR        Location/Qualifiers
FT   CDS_pept        274467..274820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplR"
FT                   /locus_tag="XNC1_0334"
FT                   /product="50S ribosomal subunit protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88416"
FT                   /db_xref="GOA:D3VHS7"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHS7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88416.1"
FT                   /translation="MDKKAARIRRATRARRKLQELGATRLVVHRTPRHIYAQVIAPNGS
FT                   ETLVAASTTEKAISEQLKFTGNKDAAAVVGKIVAERALEKGITNVSFDRSGFQYHGRVQ
FT                   ALADAAREAGLQF"
     atggataaga aagcagctcg tatccgtcgt gcgacccgcg cacgccgcaa gctccaggaa        60
     ctgggtgcaa ctcgcctggt ggtacaccgt acccctcgcc atatttatgc gcaggttatc       120
     gcaccaaatg gttctgaaac tctggtggcc gcttctacaa cagaaaaagc tatcagtgaa       180
     caactgaaat ttactggaaa caaagatgcc gcagcagtag ttggtaaaat tgttgctgaa       240
     cgtgctctgg aaaaaggtat cacaaatgta tcctttgacc gttctggttt ccaatatcat       300
     ggtagagtcc aggcactggc agatgctgcc cgtgaagctg gccttcagtt ctaa             354
//

If you have problems or comments...

PBIL Back to PBIL home page