(data stored in ACNUC1104 zone)

EMBL: FN667742.RPMA

FN667742.RPMA        Location/Qualifiers
FT   CDS_pept        422794..423051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0091"
FT                   /gene="rpmA"
FT                   /locus_tag="XNC1_0491"
FT                   /product="50S ribosomal subunit protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88565"
FT                   /db_xref="GOA:D3VIL5"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIL5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88565.1"
FT                   /translation="MAHKKAGGSTRNGRDSESKRLGVKRFGGESVLAGSIIVRQRGTKF
FT                   HAGNNVGCGRDHTLFALADGKIKFEVKGPKNRKFISIEAE"
     atggcacaca aaaaggctgg cggctcgact cgtaacggtc gcgattctga aagtaaacgt        60
     ctgggtgtaa aacgttttgg tggtgagtct gttttggcag gcagcatcat cgttcgtcag       120
     cgtggtacta aattccacgc aggcaacaac gtaggttgtg gccgtgacca caccctgttc       180
     gcattagctg acggaaaaat taaattcgaa gttaaaggtc caaaaaaccg taaatttatc       240
     agcatcgaag ctgaataa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page