(data stored in ACNUC1104 zone)

EMBL: FN667742.RPMB

FN667742.RPMB        Location/Qualifiers
FT   CDS_pept        complement(160619..160855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0034"
FT                   /gene="rpmB"
FT                   /locus_tag="XNC1_0174"
FT                   /product="50S ribosomal subunit protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88262"
FT                   /db_xref="GOA:D3VGX7"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88262.1"
FT                   /translation="MSRVCQVTGKRPVSGNNRSHALNATKRRFLPNLHSHRFWVESEKR
FT                   FVTLRVSVKGMRVIDKKGIDTVLAELRARGEKY"
     atgtcccgag tctgccaagt taccggcaag cgcccggtga gtggtaacaa ccgctcccac        60
     gcattaaatg cgactaagcg tcgttttctg cctaacctgc actctcaccg tttctgggtt       120
     gagtctgaga aacgttttgt aactctgcgt gtatctgtta aaggtatgcg tgtgattgac       180
     aaaaagggta tcgatacagt tcttgctgaa ctgcgtgccc gtggtgagaa gtactaa          237
//

If you have problems or comments...

PBIL Back to PBIL home page