(data stored in ACNUC1104 zone)

EMBL: FN667742.RPMJ

FN667742.RPMJ        Location/Qualifiers
FT   CDS_pept        277331..277447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rpmJ"
FT                   /locus_tag="XNC1_0339"
FT                   /product="50S ribosomal subunit protein X"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88421"
FT                   /db_xref="GOA:D3VHT2"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHT2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88421.1"
FT                   /translation="MKVRASVKKLCRNCKIVKRNGIVRVICSAEPKHKQRQG"
     atgaaagttc gtgcttccgt caagaaatta tgccgcaact gcaaaatcgt taaacggaac        60
     ggtatcgttc gtgtgatttg tagtgcagag cctaagcata aacagcgcca aggctaa          117
//

If you have problems or comments...

PBIL Back to PBIL home page