(data stored in ACNUC1104 zone)

EMBL: FN667742.RPSC

FN667742.RPSC        Location/Qualifiers
FT   CDS_pept        270166..270840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rpsC"
FT                   /locus_tag="XNC1_0323"
FT                   /product="30S ribosomal subunit protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88405"
FT                   /db_xref="GOA:D3VHR6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHR6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88405.1"
FT                   /translation="MGQKVHPNGIRLGIVKPWNSTWYANTKEFADNLDSDFKVRQYLNK
FT                   ELVKASISRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKAVADIAGVPAQINIA
FT                   EVRKPELDAKLVADSISSQLERRVMFRRAMKRAVHNAMRLGAKGIKEEVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQAEKTGC
FT                   ST"
     atgggtcaga aagtacatcc taatggtatt cgtctgggga ttgtcaagcc ttggaactct        60
     acctggtatg cgaataccaa agaattcgct gacaacctgg acagcgactt taaagttcgc       120
     cagtacttga ataaagaact ggttaaagca tctatttcac gtatcgttat cgaacgtcct       180
     gcgaaaagca tccgtgtgac cattcacact gctcgtccag gcatcgtaat cggtaaaaaa       240
     ggtgaagacg ttgaaaaact gcgtaaggct gtagcggata tcgctggcgt tcctgcgcag       300
     attaatattg ccgaagtgcg taaacctgaa ctggacgcaa aactggttgc tgacagcatc       360
     agctctcagt tagagcgtcg tgttatgttc cgtcgtgcta tgaaacgtgc ggtacataac       420
     gctatgcgtc tgggcgctaa aggcatcaaa gaggaagtca gtggccgtct gggcggcgct       480
     gaaatcgcgc gtactgaatg gtatcgtgaa ggtcgtgtac ctctgcacac tctgcgtgca       540
     gacatcgact acaatacttc tgaagcgcac accacttatg gtgtaatcgg cgttaaggta       600
     tggatcttca aaggtgagat cctgggtggt atggctgcag ttgaacaggc ggaaaaaacc       660
     ggctgctcaa cctaa                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page