(data stored in ACNUC1104 zone)

EMBL: FN667742.RPSM

FN667742.RPSM        Location/Qualifiers
FT   CDS_pept        277596..277952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0065"
FT                   /gene="rpsM"
FT                   /locus_tag="XNC1_0340"
FT                   /product="30S ribosomal subunit protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88422"
FT                   /db_xref="GOA:D3VHT3"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHT3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88422.1"
FT                   /translation="MARIAGINIPDQKHTVIALTSIYGIGKTRSQAICAAAGIAENVKI
FT                   RELSEEQIDKLRDEVAKYVVEGDLRREVTLSIKRLMDLGCYRGLRHRRGLPVRGQRTKT
FT                   NARTRKGPRKPIKK"
     gtggcccgta tagcaggcat taacattcct gatcagaaac ataccgtaat cgcgttaacc        60
     tcgatctatg gtatcggcaa aacccgctca caggctatct gtgcagcagc aggcattgct       120
     gaaaatgtta agatcagaga gctgtctgaa gagcaaattg acaagctgcg tgacgaagtt       180
     gctaaatacg ttgtagaagg tgatttgcgt cgtgaagtaa ccctgagtat caaacgtctg       240
     atggatcttg gttgctatcg tggtttgcgt catcgtcgtg gtctgccagt tcgcggtcag       300
     cgtactaaga ccaatgcacg tacccgtaag ggtccgcgta agccgatcaa gaaataa          357
//

If you have problems or comments...

PBIL Back to PBIL home page