(data stored in ACNUC1104 zone)

EMBL: FN667742.RPSN

FN667742.RPSN        Location/Qualifiers
FT   CDS_pept        273178..273483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rpsN"
FT                   /locus_tag="XNC1_0331"
FT                   /product="30S ribosomal subunit protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88413"
FT                   /db_xref="GOA:D3VHS4"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHS4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88413.1"
FT                   /translation="MAKQSMKARDVKRAKLAEKFFAKRVELKAIISDVNASDEDRWNAV
FT                   LKLQTLPRDSSPCRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW"
     atggctaagc aatcaatgaa agcacgtgat gtaaaacgtg cgaaattagc tgagaaattc        60
     ttcgcaaaac gcgttgaact gaaagcgatc atctctgatg tgaacgcatc tgatgaagac       120
     cgttggaatg ctgttcttaa gctgcaaaca ctgccacgtg attccagccc ttgccgtcag       180
     cgtaaccgct gccgtcagac tgggcgtccg catgcatttt tgcggaagtt tgggttgagc       240
     cgtattaaag tccgtgaagc cgctatgcgc ggtgaaattc cgggccttaa aaaggctagc       300
     tggtaa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page