(data stored in ACNUC1104 zone)

EMBL: FN667742.RPSR

FN667742.RPSR        Location/Qualifiers
FT   CDS_pept        400049..400276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0086"
FT                   /gene="rpsR"
FT                   /locus_tag="XNC1_0467"
FT                   /product="30S ribosomal subunit protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88541"
FT                   /db_xref="GOA:D3VIJ1"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIJ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88541.1"
FT                   /translation="MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRIT
FT                   GTRAKYQRQLARAIKRARHLSLLPYTDRHQ"
     atggcacgtt atttccgtcg tcgcaaattc tgccgcttca cagcggaagg cgtacaagag        60
     atcgattata aagacattgc tacgctgaaa aactacatta ccgaaagtgg taaaattgta       120
     ccaagccgta ttaccggcac tcgtgcaaaa taccagcgtc agctcgctcg tgctatcaag       180
     cgtgctcgcc atctgtctct gttgccatac actgatcgtc atcagtaa                    228
//

If you have problems or comments...

PBIL Back to PBIL home page