(data stored in ACNUC1104 zone)

EMBL: FN667742.THIG

FN667742.THIG        Location/Qualifiers
FT   CDS_pept        complement(498303..499070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0110"
FT                   /gene="thiG"
FT                   /locus_tag="XNC1_0582"
FT                   /product="thiamin biosynthesis enzyme subunit, with ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88656"
FT                   /db_xref="GOA:D3VIV6"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIV6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88656.1"
FT                   /translation="MLKIADTTFHSRLFTGTGKFANAGLMIDAIRASGSQLVTMAMKRI
FT                   DLHGNDDGILVPLQQLGVKLLPNTSGAKTAEEAVFAARLAKEALGTHWVKLEIHPDVKY
FT                   LLPDPIETLKAAEQLLKEGFIVLPYCGADPVLCRRLEEAGCAAVMPLGAPIGSNKGLLT
FT                   RDFLQIIIEQANVPVVVDAGIGAPSHALTAIEMGADAVLVNTAIAVARHPVKMAQAFKT
FT                   AIEAGELSHQAGVASQKSHAETSSPLTDFLGAL"
     atgttaaaga ttgctgatac tacttttcac tcccgcctat ttaccggaac cggcaaattt        60
     gctaatgccg gattaatgat cgacgcgatc cgcgcttctg gcagccaatt agtgacaatg       120
     gcgatgaaac gcatcgatct tcacggtaat gacgatggta ttctcgtgcc actgcaacag       180
     ttgggcgtca aactgctacc caatacttcc ggtgccaaaa cggcggaaga agccgtattc       240
     gccgcccgcc tggcaaagga agcattgggg actcactggg ttaagctgga gatccatccc       300
     gatgtcaaat acctgttgcc tgacccgatt gaaacgctga aagcggctga acaattattg       360
     aaagaagggt ttattgttct gccttattgt ggtgctgatc ccgtcctgtg ccggcggctg       420
     gaagaggctg gctgtgctgc tgtcatgcca ttgggggcac ctatcggctc aaataaaggc       480
     ttattaacgc gcgattttct gcaaatcatc atcgaacagg ctaatgttcc cgtcgttgtt       540
     gatgctggca ttggcgcgcc gagccatgcg ctgacagcca tcgaaatggg tgcggatgct       600
     gttctggtca acaccgcgat tgcggttgcc cgccatccgg tcaaaatggc tcaagcgttt       660
     aaaaccgcca ttgaagcggg cgagctttca catcaggcgg gtgtagcgag ccagaaatcc       720
     catgccgaga cttccagtcc attgaccgat tttctggggg cgttatga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page