(data stored in ACNUC1104 zone)

EMBL: FN667742.TRKA

FN667742.TRKA        Location/Qualifiers
FT   CDS_pept        complement(281456..282832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0066"
FT                   /gene="trkA"
FT                   /locus_tag="XNC1_0347"
FT                   /product="potassium transport protein, NAD(P)-binding (Trk
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88429"
FT                   /db_xref="GOA:D3VHU0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHU0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88429.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVDENNDITVVDTDTNRLRQLQDKFDL
FT                   RVVNGHGSHPRVLREAGAEDADMLVAVTNSDETNMIACQIAYSLFNTPNKVARIRSSEY
FT                   IRESEKLFQPDDIPIDYLISPEQLVIDYIYKLIQYPGALQVVNFAEGRVSIVAVKAYYG
FT                   GSLVGNALSSLREHMPHIDSKVAAIFRQDRPIRPQGSTVIEAGDEVFFVAASQHIRAVM
FT                   SELQRLEKPYKRIMIVGGGNVGAGLALRLEKDYSVKLIEHNQERAIELAELLHDTIVFY
FT                   GDASDQELLAEEHIEQVDVFIALTNDDEANIMSAMLAKRMGAKKAMVLIQRSAYVDLVQ
FT                   GGVIDIAISPQQATVSALLGHVRKADIVSVFSLRRGVAEAIEAIAHGDENTSKVVGRKI
FT                   GDIKLPPGTTIGAIVRDEEVIIANDYSIIEQGDHVIMFITDKKFVPEVEKLFQPSPFFL
FT                   "
     atgaagataa ttattctggg tgccggtcag gttggtggaa cgttagccga gaatttggtt        60
     gatgaaaaca atgatattac tgtcgttgat accgatacaa atcgcttacg tcagttgcag       120
     gataaattcg atctcagagt tgtaaatggt catggctctc atcccagagt attaagggaa       180
     gcaggcgctg aagatgctga tatgttggta gcagttacaa attcagatga aaccaacatg       240
     atcgcatgcc aaattgctta ctctttattt aatacaccga ataaggtagc cagaatacgg       300
     tcatcagaat atattcgaga atcagaaaag ttatttcaac ctgatgatat tcctattgac       360
     tatctaatat ctcctgagca attggtcatt gattacatct ataaattgat tcaataccct       420
     ggagctttgc aggtcgttaa ttttgcggaa gggcgtgtta gtatcgtcgc agttaaggcc       480
     tattatggcg gctctttagt aggtaatgct ttatcctctc tccgagaaca tatgccgcat       540
     attgatagca aggttgcagc aatctttcgt caagatcgcc caattagacc acaaggttca       600
     acagttattg aagctggaga cgaagtattc tttgttgctg catcgcaaca tatcagggct       660
     gtaatgagtg aactacaacg ccttgaaaaa ccatataaac gcataatgat tgttggtggc       720
     ggcaatgttg gtgcaggctt agctttgcgg cttgaaaaag actatagtgt caaactgatt       780
     gaacataatc aagaaagagc catagaacta gcagaactat tacacgatac tatcgtgttt       840
     tatggggatg cttcagacca agaactactt gctgaagaac atatagagca agttgatgtt       900
     tttattgcat taacaaatga tgatgaagcc aatattatgt cggctatgct tgcgaaacgg       960
     atgggagcca aaaaagcaat ggtactgatt cagcgcagcg catatgttga tttagtacaa      1020
     ggaggagtca ttgatattgc gatatctcct caacaggcaa cagtatcagc actacttggt      1080
     catgtccgta aagcagatat tgtcagtgta ttctcattaa gaaggggagt tgctgaagct      1140
     atcgaggcta tcgcacatgg tgatgaaaat acttcaaaag ttgttggacg caaaataggt      1200
     gatataaaac tacctccagg aacaacaatt ggcgctattg tgcgcgatga agaggtcatc      1260
     attgctaatg attacagcat tattgagcaa ggtgaccatg tgatcatgtt tattactgat      1320
     aaaaaattcg ttcctgaagt ggaaaaattg ttccagccaa gccctttctt tctttga         1377
//

If you have problems or comments...

PBIL Back to PBIL home page