(data stored in ACNUC1104 zone)

EMBL: FN667742.TUFB

FN667742.TUFB        Location/Qualifiers
FT   CDS_pept        258325..259509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufB"
FT                   /locus_tag="XNC1_0297"
FT                   /product="putative protein chain elongation factor EF-Tu;
FT                   GTP-binding factor (duplicate of tufA)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88379"
FT                   /db_xref="GOA:D3VHP0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHP0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88379.1"
FT                   /translation="MSKEKFERSKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNAR
FT                   AFDQIDNAPEEKARGITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAVL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDTPIIRGSALKALEGEAEWEAKIIELAEALDSYIPEPERDIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIVKVGDEVEIVGIKETTKTTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   TKRDEIERGQVLAKPGSIKPHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNINMIVSLIHPIAMDEGLRFAIREGGRTVGAGVVAKVIA"
     atgtctaaag aaaagtttga acgttcaaaa ccgcacgtta acgttggtac tatcggccac        60
     gttgaccacg gtaaaactac cctgactgct gcaatcacca ccgttctggc aaaaacctac       120
     ggcggtaacg cgcgtgcatt tgaccagatc gataacgcgc cagaagaaaa agcgcgtggt       180
     atcaccattt ctacttctca cgtagaatat gataccccaa ctcgccacta cgcacacgtt       240
     gactgcccag gccacgccga ctatgttaaa aacatgatca cgggtgcggc acagatggat       300
     ggcgcggttc tggttgttgc tgcaactgat ggcccaatgc cacagactcg tgagcacatc       360
     ctgctgggcc gtcaggtagg cgttccatac atcatcgtgt tcctgaacaa atgtgacatg       420
     gttgatgatg aagagctgct ggaactggta gaaatggaag tccgtgagct gctgtctcag       480
     tacgatttcc caggcgacga cacgccaatc atccgtggtt ctgctctgaa agcgctggaa       540
     ggcgaagcag agtgggaagc gaaaatcatc gaactggctg aagcactgga ttcttacatc       600
     ccagaaccag agcgtgacat tgacaagcca ttcctgctgc caatcgaaga cgtcttctcc       660
     atctccggcc gtggtactgt agttaccggt cgtgttgagc gtggtatcgt taaagtgggc       720
     gacgaagttg aaatcgtggg tatcaaagaa accaccaaaa caacttgtac cggcgttgaa       780
     atgttccgca aactgctgga cgaaggccgt gcgggcgaga acgttggtgt tctgctgcgt       840
     ggtactaagc gtgacgaaat cgaacgaggt caggtattgg ctaaacccgg ttcaattaag       900
     ccacacaccc agttcgaatc tgaagtgtat atcctgagta aagatgaagg tggccgtcat       960
     actccattct tcaaaggtta ccgtccacag ttctacttcc gtacaactga cgtaaccggt      1020
     actatcgaac tgccagaagg cgttgagatg gtcatgccag gtgacaacat caacatgatc      1080
     gttagcctga ttcatccaat cgcaatggac gaaggtctgc gtttcgcaat ccgtgaaggc      1140
     ggccgtactg taggtgctgg tgttgttgct aaagttattg cttaa                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page