(data stored in ACNUC1104 zone)

EMBL: FN667742.WZXE

FN667742.WZXE        Location/Qualifiers
FT   CDS_pept        327158..328408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0071"
FT                   /gene="wzxE"
FT                   /locus_tag="XNC1_0392"
FT                   /product="O-antigen translocase in LPS biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88469"
FT                   /db_xref="GOA:D3VHY0"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR032896"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88469.1"
FT                   /translation="MSLAKASVWTAGSTLIKIGVGLLVIKLLAVSFGPTGVGQAGNFRQ
FT                   LITVLGVLSGAGIFNGVTKYVAEYHQQPERLSALLGTSSSIILGFSTLLAVIFLLFSDA
FT                   ISVGLFGHNHYKIVVQALAFIQMGIAYANYFLAILKGFRDAQGNALAIILGSLVGVIAY
FT                   SLCYWLGGYEGTLAGLALVPALVVLPAGMMILHRKVMAFSSLKPLWDRAIASHLGKFTL
FT                   MALLTSITLPVAYIMMRNLLAARYSWEDVGIWQGVSSISDAYLQFITASFTVYLLPTLS
FT                   RLESRQEISREIVKALKFVLPAVAAASFSVWLLRDFVIWLLFSDKFTAMRDLFVWQLVG
FT                   DVLKVGAYVFGYLVIAKAALRFYILTEVSQFLLLTGFSHWLIPMNGALGAAQSYMATYI
FT                   VYFILCCSVFIIYRRRA"
     atgtcactgg ctaaagcttc tgtttggacg gcaggttcca cattgatcaa aattggtgtg        60
     ggcttgctgg tcattaaatt actggcggtg tcttttggcc caacaggtgt ggggcaagcg       120
     ggcaatttcc gccagctcat taccgtgctg ggggtattgt ctggtgcggg aatttttaat       180
     ggtgtaacca aatacgttgc tgagtatcat cagcaaccgg aaagactcag cgctttactg       240
     ggtacatcgt cctcgattat tctgggcttt tctacccttc tggccgtgat tttcctttta       300
     ttcagtgatg ctatcagtgt gggcttattt ggtcacaacc attacaaaat agttgtgcag       360
     gcgctcgctt ttattcaaat ggggatcgca tatgccaact attttctggc aatcttaaaa       420
     ggtttcaggg atgctcaggg caatgcgctt gccattattt tgggtagctt agtcggggtg       480
     attgcttata gtctctgtta ttggctggga ggctatgaag ggacattggc agggttggcc       540
     ttggtgcccg cgctggtggt tttaccggcg gggatgatga tcctgcatcg caaagtcatg       600
     gcattttcct cattgaagcc cctatgggat cgcgcgattg ccagccattt gggaaaattt       660
     accttaatgg cgttgctgac gtccattaca ctgcctgtcg cttatattat gatgagaaac       720
     ctgctggcag cacgttatag ctgggaagac gttggaatct ggcagggggt aagcagcatt       780
     tcggatgctt atttacaatt tattaccgca tcttttactg tctatctctt gccgacactc       840
     tcccgtttgg aaagcaggca agaaattagc cgcgaaattg tgaaagcgct gaaattcgtt       900
     ttgcctgcgg tggctgccgc cagcttctca gtctggttat tgcgcgattt tgtcatttgg       960
     ctgctgtttt cagataaatt taccgcgatg cgggatctat ttgtatggca gttagtgggc      1020
     gatgtgctga aagtgggggc gtatgttttt ggttatcttg tgatagcgaa agccgcactg      1080
     cgtttttata tactgactga agtcagccag tttctcctgc tgacgggctt ctcccattgg      1140
     ctgataccga tgaacggcgc attgggcgcg gctcagtcct atatggcaac ttacattgtt      1200
     tacttcattc tttgttgtag cgtatttatt atttatcgca ggcgagcatg a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page