(data stored in ACNUC1104 zone)

EMBL: FN667742.WZYE

FN667742.WZYE        Location/Qualifiers
FT   CDS_pept        329508..330935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0072"
FT                   /gene="wzyE"
FT                   /locus_tag="XNC1_0395"
FT                   /product="putative ECA polymerization protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88472"
FT                   /db_xref="GOA:D3VHY3"
FT                   /db_xref="InterPro:IPR010691"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHY3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88472.1"
FT                   /translation="MTLAQFSGLLVVYVISLVFILTLTYQEFRRVRFNFNIFFSLLYLL
FT                   TFYFGFPLTSMLVFKFDVEVVPVDALLHAMLASSCFYAIYYVAYKTRLSYKIRSHSDIE
FT                   SDTPSAAVSRKPLFTMNRVETNLTWLLLAGIAFFTVGSFFMQNGFLLFKLQSYSQIFSS
FT                   QVSGVALKRFFYFFIPAMLVVFFLKPTKIRWVCFLVGTVGFGILTYVIVGGTRANIIIA
FT                   FALFLFIGIVRGWITLWMLFAAGGMGIIGMFWLALKRYSLDVSGAEAFYTFLYLTRDTF
FT                   SPWENLALLLDNYSKIDFQGLAPIIRDFYVFIPSWLWPDRPNLVWNTANYFTWDVLNNH
FT                   SGLAISPTLIGSLVVMGGVFFIPLGAIMVGFIIKWFDWVYEAGKQETNRYKAAILQAFC
FT                   FGAIFNMIVLAREGVDSFVSRVVFFCIVFGLCLIAAKLLYWLFESAGLIRKFVVSNLTA
FT                   SQKAAVILDVRKKNGVE"
     atgaccttgg cacaattcag tgggttactt gtcgtttacg tgatctcatt ggtcttcatc        60
     ctgactttga cgtatcagga gtttcggcgt gtccgcttta actttaatat tttcttttct       120
     ttattgtatt tgctgacatt ttatttcggt ttcccgttga ccagtatgct ggtattcaag       180
     tttgatgtcg aagttgtgcc tgtggatgct ttgctgcatg caatgctggc atcaagctgt       240
     ttttacgcta tttattatgt cgcttataaa acccggctca gttataaaat ccgcagtcat       300
     agtgacatag aatcagacac accctctgct gcggtatcgc gtaagccctt gtttaccatg       360
     aatcgggtgg aaactaatct gacctggttg ttacttgccg gcattgcgtt ttttacagtc       420
     ggttcgtttt ttatgcaaaa tggcttctta ctgttcaaat tgcagtctta tagccagata       480
     ttttccagtc aagtttctgg tgtggctctt aagcgatttt tctatttttt catccctgcg       540
     atgttggtgg tgtttttcct gaaaccgacg aaaatccgtt gggtgtgttt tctggtagga       600
     acggtagggt ttggcatcct gacttatgtc atcgtcggcg gaacgcgggc taacattatt       660
     atcgcgtttg cgttgttctt gtttatcggg attgtccggg gctggattac gttgtggatg       720
     ttgtttgcag cgggtggcat ggggatcatc ggcatgttct ggctggcgtt gaagcgttac       780
     agtttggacg tgagtggtgc cgaagcattt tatactttcc tgtacctcac ccgggatact       840
     ttctccccgt gggaaaacct ggcactgtta ttggataact acagcaaaat agattttcag       900
     gggctggcac cgattatccg tgatttttat gtctttattc ccagctggct atggccagac       960
     agacctaatc tggtttggaa tacagcgaat tactttacgt gggatgtatt gaataatcac      1020
     tctggtttgg ctatttcacc gacattaatt ggttcgcttg tggttatggg gggcgtattc      1080
     tttatcccct tgggcgcgat catggtgggt tttattatca aatggtttga ttgggtttat      1140
     gaagcaggaa aacaggaaac caatcgttat aaggctgcga ttttgcaggc tttctgtttt      1200
     ggtgcaattt tcaacatgat tgtccttgcc cgggaaggtg tcgattcttt tgtttctcgg      1260
     gtggtgttct tttgtattgt ctttggcctg tgtctgatcg cagctaagtt actgtattgg      1320
     ttatttgaaa gcgccgggct gatccgaaag tttgtcgtca gtaatttgac ggcatcgcaa      1380
     aaagcagctg ttatcttgga tgtaaggaag aaaaatgggg ttgaataa                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page