(data stored in ACNUC1104 zone)

EMBL: FN667742.WZZE

FN667742.WZZE        Location/Qualifiers
FT   CDS_pept        319808..320878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0071"
FT                   /gene="wzzE"
FT                   /locus_tag="XNC1_0385"
FT                   /product="modulator of enterobacterial common antigen (ECA)
FT                   polysaccharide chain length"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88462"
FT                   /db_xref="GOA:D3VHX3"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032895"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHX3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88462.1"
FT                   /translation="MINSETKSKQDQPAIEYELDVRTLCRALWKGKIWIIALAMIFAAV
FT                   ALGASYLMQQKWSATAIVDLPTTNNLGSYYSQQQFLRNLDTHINASPEAQLPTIPDGAY
FT                   KEFMTQVAAYDTRREFWLHSDYYKQRREGGAKADAVLLDELINDIKITRGDDKNAPNDS
FT                   IKLTAETATDSNQLLRKYIAFANQRASEHLNNEIKGAWATRTQSMKALVKRQEMVAKAM
FT                   YTRELNVLQQSSNVAEKQGIHRNQTDIPIEELPESKMFMLGTSLLQAQIETLEATGPDY
FT                   SIDYDQNIAMLATLNVGPTLQDTFQTYRYLRTPEEPVGRDSPRRIFMMVMWGAVGMLMG
FT                   AGLALVRRHRYSNPEQ"
     gtgataaact cagaaacgaa atctaaacag gatcaacctg ctatagagta tgagttggat        60
     gttcgtacgt tatgtcgtgc tctatggaaa ggaaagatat ggattatcgc actggcaatg       120
     attttcgctg ccgtggctct gggcgcatcg tatctgatgc agcaaaagtg gagcgcaacc       180
     gctattgtgg atttaccgac aaccaataat ctgggtagct actattcgca acaacaattt       240
     ttgcgtaatc tggataccca tatcaatgcc tcgccagaag ctcaattgcc gaccattcct       300
     gatggtgcat ataaagaatt tatgacacag gtcgcggcat atgacactcg tcgcgaattc       360
     tggcttcatt ctgattatta caaacagcgc agggaagggg gagccaaagc ggatgctgtg       420
     ctgctggatg aattgatcaa tgatattaag atcacacgcg gtgatgacaa aaacgcgccg       480
     aacgacagta tcaaattaac ggcagaaaca gcgactgatt ctaatcagct tctgcgcaaa       540
     tatattgcgt ttgctaatca gcgggcgagt gagcacctga ataatgaaat taaaggtgca       600
     tgggcaacgc gtactcagtc aatgaaagcg ttggtcaaac gtcaggagat ggttgccaag       660
     gcaatgtata cacgcgaatt gaatgtcttg cagcagtctt cgaacgtggc tgagaagcaa       720
     ggtattcacc gtaatcaaac agacattcct attgaagaat tgccagaatc caaaatgttc       780
     atgctgggta cgtcattgtt gcaagcccag attgaaacgt tggaagcgac cggtcctgac       840
     tacagtatcg attatgatca aaatatagcg atgctggcga cactgaatgt cggcccaacc       900
     ctgcaagaca ctttccaaac ttaccgttat ctcagaacac cggaggaacc ggttggccgg       960
     gatagtcccc gtcgtatttt tatgatggtt atgtggggtg ctgttggcat gttgatgggt      1020
     gccggtttgg ccttggtcag acgccatcgt tacagcaacc cagagcaata a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page