(data stored in ACNUC1104 zone)

EMBL: FN667742.YBGL

FN667742.YBGL        Location/Qualifiers
FT   CDS_pept        542853..543620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0118"
FT                   /gene="ybgL"
FT                   /locus_tag="XNC1_0631"
FT                   /product="putative lactam utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0631"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88702"
FT                   /db_xref="GOA:D3VJE6"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJE6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88702.1"
FT                   /translation="MIKTIDLNSDLGEGFGQWRMGNDKAMLEIVSSANIACGFHAGDPA
FT                   GILQTLNSAKKNNVVIGAHVSYPDLVGFGRRKMDIASHELTADVIYQIAALQGLAKTVN
FT                   TKVSYIKPHGALYNTIANDEYQAMAVIDGILAIDPCLTLVGLAGSNILRLAQEKGLKTI
FT                   AEAFADRAYTSKGELVSRRESGSVLHNADLVARRMLQLVTEGGVESIDGKFTPIQADSI
FT                   CVHGDSPGSVEMAREVKTVLEQSGITIRSFICP"
     atgataaaaa caattgattt aaatagtgat cttggtgaag gtttcggcca atggcgtatg        60
     ggaaacgata aagcaatgtt ggaaattgtc agcagtgcca atattgcctg tggctttcat       120
     gcgggagatc cggcaggaat tttgcagaca ttaaactcag caaagaaaaa taacgtagtt       180
     attggcgctc atgtttctta tcccgatttg gttggttttg ggcggcgtaa aatggatatt       240
     gccagtcatg aacttacagc agacgtgatt taccagattg cagctttgca aggattagct       300
     aaaacggtaa atacaaaggt gagttatatc aagcctcatg gtgcactgta taatacaatc       360
     gcgaatgatg aatatcaggc aatggctgtt attgacggca ttttagcgat tgatccctgc       420
     cttactttag ttggtttggc gggatcaaac attctaaggt tggcacagga aaaagggttg       480
     aaaaccattg ccgaagcttt tgctgatcgt gcctatacct caaagggaga gttagtttcc       540
     cgccgtgaat caggctctgt gctacataat gctgatcttg ttgcccgtcg tatgttacag       600
     ctggtgacag aaggtggagt tgaatcgatt gatggaaaat ttacacccat tcaggcggat       660
     tctatttgcg tgcatgggga cagccccggc tcggtggaga tggcaagaga ggtcaaaact       720
     gttttggagc agtctggaat taccattcga tcatttatct gtccataa                    768
//

If you have problems or comments...

PBIL Back to PBIL home page