(data stored in ACNUC1104 zone)

EMBL: FN667742.YDCQ

FN667742.YDCQ        Location/Qualifiers
FT   CDS_pept        complement(101830..102246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcQ"
FT                   /locus_tag="XNC1_0105"
FT                   /product="putative regulator with DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88193"
FT                   /db_xref="GOA:D3VGA3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88193.1"
FT                   /translation="MRYPVTLEPVEEGGYFVSFPDIPEALTQGETREEALEMALDALIT
FT                   SFEFYFEDNEKIPLPSPIGQDDDYVDVPLSITSKVLMLNAFIDSKLTQTELASRMGVKK
FT                   QEVTRIFDLRHSTKIDTVGKAAAVIGHQLTLSMQ"
     atgcgatatc cagtaacact agagccagtg gaagaaggcg gttatttcgt ctcgttcccg        60
     gatatccccg aagctttaac tcaaggggag acacgggaag aagcgctaga gatggcactt       120
     gatgcgctaa taacgtcttt cgaattttac ttcgaagata atgagaaaat tccgcttcct       180
     agccctatag gacaagatga cgattatgtc gatgtgccct taagcataac ctctaaggtg       240
     cttatgctta atgcgtttat tgattctaaa ttaacgcaaa ctgaactggc cagccgtatg       300
     ggagtgaaga aacaggaagt cacgcgcatc ttcgatttac ggcattcaac taagatagat       360
     acagtgggta aggcggcagc ggttatcggg caccagttaa cattgtcaat gcagtaa          417
//

If you have problems or comments...

PBIL Back to PBIL home page