(data stored in ACNUC1104 zone)

EMBL: FN667742.YDEP

FN667742.YDEP        Location/Qualifiers
FT   CDS_pept        461415..463733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeP"
FT                   /locus_tag="XNC1_0529"
FT                   /product="putative formate dehydrogenase (C-terminal),
FT                   related to acid resistance with formate dehydrogenase/DMSO
FT                   reductase, domains 1-3 and ADC-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0529"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88603"
FT                   /db_xref="GOA:D3VIQ3"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIQ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88603.1"
FT                   /translation="MKFKSKIKPYHSAAGGWGSLEATTRFVFDSKQALKNMVNLMRMNK
FT                   PKGFDCPGCAWGDDNKSLFSFCENGAKAMTWEATRRYVDRVFFATHSVSKLYQQSDYFL
FT                   EYQGRVVEPMSYNPQTDHYEPISWDNAFALIASHIKAMDNPNQLELYTSGRASNEASWL
FT                   YQLFGRVLGTNNFPDCSNMCHEASGYGMLQSLGIGKGTIRLQDFDHADAIFVFGQNPGT
FT                   NHPRMLHSLRHAAEHGARIVTFNTLRERGLERFADPQKPLEVITPMAGEISHRYYQPKL
FT                   GGDMAVVRGMVKALLETHNALLAEGKSGIFDLAFISAYTEGVDAYLQEVAMTEWSFIEN
FT                   QSGLTEAQLREAAAIYQNAERVICTWAMGITQHKHSLVTVREIINLQLLFGQLGKSGAG
FT                   LCPVRGHSNVQGNRTMGINEKPNPLFLDSMATHFGFEPPRAHGHHVVEALGAMLRDEVK
FT                   VLIALGGNLAAAAPDSPRTEEALQHCDLTVHISTKLNRSHLVTGKKGALILPTLGRTER
FT                   DIQATGPQFVTVEDSFSMVHASEGVNKPLFDTQRSETAIIAGIANATTGNTETINWLEL
FT                   AGDYNKIRDHIAATISGFEGFNKKCEHPGGFYLGNAAAELHFATPSKKAEFSHAPLPKT
FT                   LFPQIDGADVPFTLQTLRSHDQYNTTIYGLDDRYRGVYGQREVLFMNPEDIAQSGYQAG
FT                   DLVDIETIWNDGIQRKVFGFKLVPYAIPRGNLAAYYPETNPLVPMESIGEGTGTPTSKS
FT                   VPVTLSLTEQKQSEPRRIV"
     atgaaattca aatcaaaaat aaaaccttat cattctgctg ctggtggctg gggatcactg        60
     gaagcaacaa cccgctttgt ctttgacagc aaacaagccc tgaaaaatat ggttaacctg       120
     atgcgcatga ataagcccaa aggctttgat tgtccgggat gcgcatgggg agatgataat       180
     aagagcctgt tcagtttctg tgaaaatggt gctaaagcga tgacttggga agctacgcgt       240
     cgctatgttg atcgggtatt cttcgcaact catagtgtca gtaaacttta ccagcaaagt       300
     gattatttcc tcgaatatca aggccgtgtg gttgagccga tgagctataa cccacagact       360
     gaccattatg agccaattag ctgggataat gcttttgccc ttatcgccag ccacattaag       420
     gcgatggata acccaaatca gcttgagctg tatacatcgg gtcgagccag taatgaggca       480
     tcatggcttt atcaactgtt tggccgtgta ttgggaacaa ataattttcc tgattgttcg       540
     aatatgtgcc atgaagctag cggctatggg atgttgcaaa gtttgggaat cgggaaaggc       600
     acgatccggc tgcaagattt tgatcacgca gatgccatct ttgtatttgg tcaaaacccc       660
     ggaacgaacc atccgagaat gctgcatagc ttgagacatg cggctgaaca cggtgcccga       720
     attgtcactt ttaatacgtt gcgtgagcgt ggactggaac gtttcgctga tccgcaaaaa       780
     ccactcgaag ttatcacgcc aatggcggga gaaattagtc atcgttacta ccagccaaag       840
     ctgggtggag atatggcggt tgttcgggga atggttaagg cgcttttgga aacgcataac       900
     gctctgctgg ctgagggcaa atcgggtatt tttgatctgg cattcatttc tgcttatacc       960
     gaaggtgtgg acgcttattt gcaagaagtt gcaatgacag aatggtcatt tattgagaat      1020
     caatctgggt tgaccgaagc gcaattacgc gaagcagcgg ccatttatca gaatgctgaa      1080
     cgtgtcatct gtacttgggc aatgggaatc acccagcata aacactcatt agttaccgtg      1140
     cgtgaaatca tcaaccttca attgctgttt ggtcagttgg gtaaatccgg tgcagggctt      1200
     tgccccgtgc gtggtcacag taatgtgcag ggcaaccgga cgatgggaat taatgaaaaa      1260
     cccaacccgc tttttttgga tagcatggcg acccattttg gattcgaacc tccccgtgct      1320
     cacggtcatc atgtcgtgga ggccttgggc gccatgttgc gtgatgaagt caaagtactg      1380
     attgcgttag gcggtaacct tgcagcggcg gcgccagata gccctcgcac ggaagaagcc      1440
     cttcaacact gtgatttgac agtacatatc agcacaaaat taaaccggag tcaccttgtt      1500
     accggtaaaa aaggggcgct tatcctgccg actctggggc gtaccgagag agatattcag      1560
     gccacaggcc ctcagtttgt gacagtagaa gactctttca gcatggttca tgcgtcagaa      1620
     ggtgtgaata aaccgctatt tgatacccaa cggtctgaga ccgcgatcat tgcggggatt      1680
     gccaacgcaa cgacaggcaa tacagagacc attaactggc tggagttggc gggagattac      1740
     aataaaatcc gtgatcatat tgcagcaacc atttcagggt ttgagggctt taataaaaaa      1800
     tgtgagcatc ctgggggctt ctacctcggc aatgctgcgg ccgaattaca ctttgccaca      1860
     ccgagtaaaa aagccgaatt cagccatgcg ccgctgccaa aaacactgtt cccgcaaatt      1920
     gatggtgcgg acgttccttt taccctgcaa accttacgtt ctcatgacca atacaacacc      1980
     actatttatg gcttggatga tcgatatcgt ggggtttacg ggcagcggga agtattattt      2040
     atgaatccgg aagatattgc acaatcaggc tatcaggccg gcgatttggt ggatatcgaa      2100
     acaatatgga atgacggtat ccagcgtaaa gttttcggtt tcaaattagt tccttatgcc      2160
     attccgcgcg gaaacctcgc ggcttattac cctgaaacta acccattagt tccgatggaa      2220
     agcattggtg agggaacagg cacgccgact tcaaaatctg ttcctgtgac attatccctc      2280
     actgagcaaa agcaatcgga gcctcggcgt attgtataa                             2319
//

If you have problems or comments...

PBIL Back to PBIL home page