(data stored in ACNUC1104 zone)

EMBL: FN667742.YDFJ

FN667742.YDFJ        Location/Qualifiers
FT   CDS_pept        357490..358887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0079"
FT                   /gene="ydfJ"
FT                   /locus_tag="XNC1_0427"
FT                   /product="putative transport protein (MFS family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88504"
FT                   /db_xref="GOA:D3VI15"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88504.1"
FT                   /translation="MPYKNTALAVAQRQHASEAYLTTKEGRKGFWRAIFSCWLGTTIEY
FT                   ADFALYGLAAGIIFGDVFFPEMTPAVALFASFATYSVGFIARPIGALVFGWLGDRKGRK
FT                   IVMIMTVILMSVSTTLIGLIPSYAHIGAWAPACLVMLRFIQGLGAGAALSGGTVILGEF
FT                   APPARRGLVSSAIALGSNSGTLLASLVWLLVLTMDKESLLDWGWRIPFLSSAIIAIVAL
FT                   YIRRYMSETPVFERYKEMLAEQRLQALTENEKRHTDDERRSFWQRTKAFWIMMGLRIGE
FT                   NGPSYLAQGFMIGYVANVLMLDKFTPTIAVFIASILGFLIIPLAGYLSDRFGRRIIYRW
FT                   FCLLLILYAFPAFILLDSREPMIVIPTIVIGMGLASLGIFGAQAAWGVELFGVANRYTK
FT                   MALAKELGAVLSGGTAPLIASALFSFAGHWWPIACYFALMASIGFITTFFAPETRGRDL
FT                   NLLEDAI"
     atgccgtata aaaatacggc gttagctgtt gctcaaaggc aacacgcttc tgaagcgtat        60
     ctaacaacga aagaaggacg aaagggcttt tggcgagcca ttttttcctg ttggttaggc       120
     acaacaatag aatatgctga ctttgcattg tatggcttag cagcgggaat tatttttggc       180
     gatgtttttt tccccgaaat gacgcctgcc gttgctcttt ttgccagttt tgcaacttat       240
     tctgtaggat ttatcgctcg tcccattggg gcacttgtgt ttgggtggtt aggcgatcgc       300
     aaggggcgaa aaatcgtcat gataatgacg gttattctga tgagtgtttc aacaacactc       360
     attggcctta ttccaagtta cgctcatatc ggcgcctggg ctcctgcctg tttagttatg       420
     ttgcgtttta ttcaaggatt aggggcggga gccgcactat ccggcggcac agtcatattg       480
     ggagagtttg cacctccggc aagacgtgga ttagtctcgt ctgctattgc tttgggttcg       540
     aatagcggga cattattggc atcacttgtt tggttactgg tattgacgat ggataaagag       600
     agtttgctgg actggggatg gcgtattcca tttctatcca gtgcgataat tgcaatagtt       660
     gcgctctata ttcgccggta catgagtgaa acaccggttt ttgagcgtta taaagagatg       720
     ttggcagaac agcgtttaca agcattaacg gaaaatgaaa agcggcatac tgatgatgaa       780
     cgccgatctt tctggcaacg taccaaagca ttctggatta tgatgggctt acgaattggt       840
     gaaaatggtc catcttatct ggctcagggc tttatgattg gttatgttgc caatgtgttg       900
     atgctggata aatttactcc tacgatagct gtatttattg catctatcct gggttttttg       960
     atcatcccct tggcgggtta tctatccgat cgttttgggc gccgtatcat ttatcgttgg      1020
     ttctgcctat tactcatcct ctatgccttc cctgctttta tcttactgga cagccgtgaa      1080
     cccatgattg ttattccgac gattgtcata ggaatggggc tggcttccct gggtattttt      1140
     ggcgctcagg cagcatgggg agtagaactt tttggtgtcg cgaatcgtta taccaagatg      1200
     gctcttgcaa aagagttggg ggccgtgtta tcgggaggaa cggcaccatt gattgcctcg      1260
     gctttattct cttttgcagg gcattggtgg cctattgcct gttattttgc attgatggca      1320
     agtattgggt ttatcacgac attctttgcg ccagaaacac gtggacggga tctcaactta      1380
     cttgaggatg cgatttag                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page