(data stored in ACNUC1104 zone)

EMBL: FN667742.YEAW

FN667742.YEAW        Location/Qualifiers
FT   CDS_pept        483657..484775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0106"
FT                   /gene="yeaW"
FT                   /locus_tag="XNC1_0564"
FT                   /product="putative di(mono)oxygenase, alpha subunit with
FT                   ISP and Bet v1-like domains"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88638"
FT                   /db_xref="GOA:D3VIT8"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="InterPro:IPR039004"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIT8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88638.1"
FT                   /translation="MSIQDPYLTLPRNFCANPAEAYTMPARFYTSQDVFDYEKEAIFAK
FT                   SWICVAHGSELANPNDYVTREIIGESIVIVRGRDNILRAFFNVCPHRGHQLLKGEGKAK
FT                   NVITCPYHAWTFKLDGSLAHARNCENVANFDKGLAQLTPVKLEEYAGFVFINMDMNAGT
FT                   VEAQLPGLSTRVLAACPDVYDLKLAARFTTATPANWKSIVDNYLECYHCGPAHPGFSTS
FT                   VQVDRYWHTMYEKWSLQFGYAIPSDQSFKFEGESSFHGFWLWPCTMYNVTPVKGMMTVI
FT                   YEFPVDAETTLQYYDIYFTNEDITEEQKSLIEWYRDVFRPEDLRLVESVQKGLKSRGYR
FT                   GQGRIMADSTGSGISEHGIAYFHHLIAQTYHE"
     atgagcatcc aagaccctta tttgacgctg cccagaaatt tttgtgcgaa tcccgcagaa        60
     gcgtacacca tgcccgctcg tttctatact tctcaggacg tctttgatta tgaaaaagag       120
     gcgatttttg ccaagagttg gatttgtgtt gcgcacggaa gtgagcttgc caatcccaac       180
     gattatgtca cgcgtgaaat tattggtgag agtatcgtga ttgtccgtgg gcgcgacaac       240
     atattgcgtg ccttttttaa tgtctgtcct catcgcggtc atcagctatt gaagggtgag       300
     ggtaaagcga aaaacgtcat cacttgcccc taccatgcct ggacattcaa acttgatggt       360
     tctttagccc atgcgcgtaa ctgtgagaat gtggccaatt tcgacaaagg attagcacaa       420
     ttaacgccgg taaaattaga agaatatgcc ggctttgttt ttatcaatat ggacatgaat       480
     gcaggaacgg tcgaagcgca attaccggga ttaagcacca gagtattagc agcctgtcct       540
     gacgtttatg atttaaaact ggcagcgcgt ttcacgacag cgacaccggc taactggaaa       600
     agcattgttg ataactatct ggaatgttac cactgcggcc cggcacatcc ggggttttca       660
     acttcggttc aggtcgatcg ctattggcat accatgtatg agaaatggtc attgcaattt       720
     ggatatgcca ttccttccga tcaatctttc aaatttgaag gcgaatcttc atttcatggt       780
     ttttggttat ggccttgtac tatgtataac gttacgccgg ttaagggcat gatgacggtt       840
     atctatgaat ttcctgtgga tgccgagaca acactgcaat attacgatat ttactttacc       900
     aatgaagata ttacagaaga acagaaatcg ttgatcgaat ggtatcgtga cgtttttcgt       960
     ccggaagacc tgcgtttggt tgaaagtgtg caaaaggggc tgaaatcacg tggctatcgt      1020
     ggtcaggggc gcatcatggc ggatagtaca ggaagtggaa ttagcgaaca tggaattgct      1080
     tattttcacc acctgattgc ccagacctac cacgaataa                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page