(data stored in ACNUC1104 zone)

EMBL: FN667742.YECS

FN667742.YECS        Location/Qualifiers
FT   CDS_pept        complement(491343..492059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0107"
FT                   /gene="yecS"
FT                   /locus_tag="XNC1_0572"
FT                   /product="putative amino acid transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0572"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88646"
FT                   /db_xref="GOA:D3VIU6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIU6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88646.1"
FT                   /translation="MTPSWLSLALDSLWPMLYAGLTFTIPLTLITFALGISLGFIVALI
FT                   RLYGPKPLIAVVRFYVWLIRGTPLLVQLFLIFYALPSVGITLEAFTSAVIGFTLNVGAY
FT                   TSEVIRAALISVPKGQWEASHSIGMSWWQSLRRIVLPQAARFSIPPLSNTFISLVKDTS
FT                   LASVITVPEMFLAAQRIAAVTYQPLILYTEAAILYLLLSSVLSALQVRLEKKFAQQNSH
FT                   QQSSNKEAKDDSAHQH"
     atgaccccat catggctcag tttagcgctg gattccctat ggccgatgct ttacgccggt        60
     ctgacattta ctattcccct cacgctgatt actttcgcat tggggatctc actggggttt       120
     atcgttgctt taatcaggct gtatggccct aagccactga ttgcagtggt acgattttat       180
     gtctggttga tccggggtac gccgctatta gtacaactgt ttctgatctt ctacgccctg       240
     cccagcgtgg gcattacctt ggaagccttc acctccgccg ttatcggttt taccctgaat       300
     gttggtgctt atacttccga agtgatccgc gctgcattga tttcagttcc caaaggacaa       360
     tgggaagcct ctcactctat cggcatgagt tggtggcaat cactgcgccg gatcgtatta       420
     ccacaagcag cacggttttc tattcctcct ttgtccaata cctttatttc gctggtcaaa       480
     gatacgtctc tggcttccgt cattaccgtg ccagaaatgt ttctggcggc acagcgcatt       540
     gccgctgtca cttatcagcc acttattttg tataccgaag cggccattct ctatctgctc       600
     ctgagttcgg tgttgtccgc actgcaagtc cggttggaaa agaaattcgc ccagcaaaac       660
     agtcatcaac aaagcagtaa taaggaagcc aaagatgatt cagctcacca acattga          717
//

If you have problems or comments...

PBIL Back to PBIL home page