(data stored in ACNUC1104 zone)

EMBL: FN667742.YHBY

FN667742.YHBY        Location/Qualifiers
FT   CDS_pept        complement(426729..427055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbY"
FT                   /locus_tag="XNC1_0496"
FT                   /product="putative RNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88570"
FT                   /db_xref="GOA:D3VIM0"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIM0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88570.1"
FT                   /translation="MSFSIPTKQKKMTLNKKQVQYLKSLAHSLKPVVMIGNNGLTEGVL
FT                   AEIEQTLSHHELIKVKVAGEDREIKTLIAEAIVRETGAHNVQIIGKMLVLYRPSEERKI
FT                   SLPK"
     atgtcgtttt caatcccaac taagcaaaaa aagatgactc ttaacaagaa acaagttcaa        60
     tatctcaaaa gtcttgctca ttcattaaag cctgtcgtta tgatcggcaa caacgggctg       120
     accgaaggcg tattggctga aatcgaacaa actctttcgc atcacgagct tatcaaagtc       180
     aaagttgcag gcgaagaccg tgaaatcaaa actttgatcg ctgaagcgat tgttcgtgaa       240
     actggtgcac ataatgtgca aatcattgga aaaatgttag ttctctaccg tccatcagaa       300
     gaacgcaaaa ttagtctacc taaataa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page