(data stored in ACNUC1104 zone)

EMBL: FN667742.YJEE

FN667742.YJEE        Location/Qualifiers
FT   CDS_pept        384604..385065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjeE"
FT                   /locus_tag="XNC1_0451"
FT                   /product="putative enzyme with nucleoside triP hydrolase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88525"
FT                   /db_xref="GOA:D3VIH5"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIH5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88525.1"
FT                   /translation="MKELVLSLPNENATVALGNAVAAISDRGYVIYLYGDLGAGKTTFS
FT                   RGFLQALGHQGHVKSPTYTLVEPYALQPRPVYHFDLYRLADPEELEFMGIRDYFHQDSI
FT                   CLVEWPQQGTGVLPDADIELHLSYDSEGRQARFIALSEYGESLLDNLKS"
     atgaaagaac tcgttttatc acttccaaat gaaaatgcca cggttgcatt gggcaatgca        60
     gtggcagcaa tcagcgatcg cggctatgtt atttatttat atggcgatct tggtgcaggg       120
     aaaacgacat tcagtcgcgg tttcctacag gcacttgggc atcaggggca tgtaaaaagt       180
     ccgacgtata cgctggtcga accttatgcc ttacaaccac ggcctgttta tcattttgat       240
     ctttaccgtc tggctgaccc tgaagagctg gaatttatgg gtattcgtga ctatttccat       300
     caggattcta tttgcttggt tgaatggcct caacaaggta caggtgtctt gcctgacgcg       360
     gatattgagc tgcatttgag ttatgacagc gaagggcgac aggcacgttt tattgcctta       420
     tctgaatatg gtgaaagtct gttggataat ttaaagtcct ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page