(data stored in ACNUC1104 zone)

EMBL: FN667742.YRDA

FN667742.YRDA        Location/Qualifiers
FT   CDS_pept        complement(289255..289812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrdA"
FT                   /locus_tag="XNC1_0356"
FT                   /product="putative acyl transferase with trimeric LpxA-like
FT                   domain , ferripyochelin-binding"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88438"
FT                   /db_xref="GOA:D3VHU9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHU9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88438.1"
FT                   /translation="MSTVLRQYLDLYPQVGRKVFLDSSSVVIGDVRLAEDISIWPLVVI
FT                   RGDVNYVSIGSRTNIQDGSVLHVTHKSRDNPNGFPLIIGEDVTVGHKAILHGCTVGNRV
FT                   LVGMGSILLDGVIVEDDVIIGAGSLVPPRKKLESGYLYVGSPAKQVRKLKPEELEGLLY
FT                   SANNYARWKDDYLLAEQSEGKE"
     atgtccactg tgttacgtca atatttagac ttatatcctc aggttggtcg aaaagtcttt        60
     ttagattctt cttctgtagt gatcggtgat gtcagattgg ctgaagatat aagtatctgg       120
     ccccttgtag tgattcgggg agatgtcaac tatgtatcaa ttggttcgcg cacgaatatt       180
     caagatggct ctgttttgca cgtaactcat aaatctcgtg ataacccaaa tggatttcct       240
     ctgataatag gtgaagatgt cacagtaggt cataaagcga tattgcatgg atgtaccgtt       300
     ggaaatagag tgttagtcgg aatgggatct attttacttg atggcgtaat tgttgaagat       360
     gatgtaatta tcggtgccgg tagtcttgtt ccccccagaa aaaaattaga aagtggatat       420
     ctatacgtag gtagcccagc caaacaagtg agaaaactca aacctgaaga attggaagga       480
     ctactttatt cagctaataa ctatgctcgc tggaaagatg actatttatt agcagaacag       540
     tctgagggta aagaatag                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page