(data stored in ACNUC1104 zone)

EMBL: FN667742.YRDC

FN667742.YRDC        Location/Qualifiers
FT   CDS_pept        287628..288197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0067"
FT                   /gene="yrdC"
FT                   /locus_tag="XNC1_0353"
FT                   /product="putative RNA-binding protein with unique protein
FT                   fold, with YrdC/RibB domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88435"
FT                   /db_xref="GOA:D3VHU6"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHU6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88435.1"
FT                   /translation="MSNEISPAFDSIVTALKEGKVIAYPTEAVFGLGCDPDSENAVQEL
FT                   LALKNRPWEKGLILIADNYERLCSYIDDVQLSDEQKETIFSFWPGPVTWVIPAKKITPK
FT                   WLTGKFSTLAVRVTDHPLVKQLCSLYGKPLVSTSANLSGLEPCRSVEEVRLQFGNRIPV
FT                   LSGEVGGRKNPSEIRDALTGKLYRQG"
     atgagtaacg aaatctcacc tgcatttgat tcaattgtca cggctttgaa agaaggaaaa        60
     gtgattgctt atccgacgga agctgttttt ggtttaggat gtgatcccga tagtgaaaac       120
     gctgtacaag aattattagc gttgaaaaac aggccgtggg aaaaaggact aatccttatc       180
     gctgacaatt atgagaggct atgctcttat attgatgatg tgcaattgag tgatgaacag       240
     aaagaaacca tattttcatt ttggccgggg cctgttacat gggtcattcc agcaaaaaaa       300
     ataacaccaa aatggctgac gggtaagttt tcaactttgg cagtcagagt cacagatcat       360
     cctttagtta aacagctatg ctccctgtac ggaaaaccac ttgtttcaac gagtgcgaat       420
     ttaagtgggt tagaaccatg ccgcagtgtg gaagaagttc gcctgcaatt tggaaatcgt       480
     atcccggttt tgtcaggaga agtaggagga cgcaaaaacc catcagaaat cagagatgct       540
     ttaactggca aactatatcg gcaaggatag                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page