(data stored in ACNUC7421 zone)

EMBL: FN667743.PE111

FN667743.PE111       Location/Qualifiers
FT   CDS_pept        98995..99306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0111"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0111"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92979"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92979.1"
FT                   /translation="MSIIFSGHYCMKYRTLLLDALRLHFDEHLSRLDVGRRLGIPKSTL
FT                   CALFVRFKKLGMSWPLPDNMTADKLESQLYPARPHAVRLDIPAPVLGVLCPMHPKVPW"
     gtgtccatca tttttagtgg acattattgt atgaaatatc ggacattgct cctcgacgct        60
     ttgcgcttac attttgatga acacctatcc agactcgatg ttggccgtcg gcttgggatc       120
     cccaaaagca ccctctgcgc tctctttgtt cgcttcaaaa agctgggaat gagctggccg       180
     ctgcctgata acatgaccgc cgataagctc gaatcgcaac tttaccccgc gcgtccccat       240
     gccgtcaggc ttgatatccc tgcgcctgtt ttaggggttt tgtgcccgat gcatccaaaa       300
     gttccatggt ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page