(data stored in ACNUC7421 zone)

EMBL: FN667743.PE119

FN667743.PE119       Location/Qualifiers
FT   CDS_pept        107320..109104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0119"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92987"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92987.1"
FT                   /translation="MWSDKESSEDYLNFGEVSQLAVDVLTTEGMLPVSIGIFGNWGAGK
FT                   SSLLKLIEQKLEKDDKDWIVINFDSWLYQGYDDARAALLEVIATSLTKAADGNASIVSK
FT                   AKKLLSRVDGFRAMGFLAEGAALFAGVPTGGFLARGLGALRNVSDGIQSQEEYEDLGNL
FT                   AKESKEKVGNLLKPEVKKSPPQQIEAFRKEYGEILEELGKPLIVIIDNLDRCLPANAIH
FT                   TLEAIRLFLFLTNTAFIIAADEDMIRSSVSDYFKGASQRHQIDYLDKLIQVPIRVPKAG
FT                   VREIRSYLFMLYAIEHGLKGEKLTNLRDGLERALQHSWKDEPISRQDVLKMTGESEDSN
FT                   LALAFARADRIAPVLANSPIIHGNPRIVKRLLNVVKMRSQIAKRRAMPLDEAIITKLVI
FT                   FERCVGVDGTADLYHLVDIEQGMPQLLKQLEDTNGQVPSEAPKTWTDNPTTKAFIAQWA
FT                   QLEPRLGGIDLRAAIYLSRETMPIGAYVVGLSPSGREVLNALIELKNTSSPTAEDLLKT
FT                   LPREEQVPVMEGLISQLRQVSDWARKPKGFSGACLLARHSADAASILIRFLQELQLGMK
FT                   RPAWMTAALKDEQWNKDA"
     atgtggtcag acaaggaatc atcagaagat tacctaaatt ttggagaagt atcccaatta        60
     gccgtcgatg tgctcactac cgaaggtatg ttaccagtat cgataggcat ttttggtaat       120
     tggggtgctg gcaaatcctc actcttgaaa ctgatagagc aaaaacttga gaaagatgat       180
     aaggattgga ttgttatcaa ctttgactcc tggctctatc aaggttatga cgacgctcga       240
     gctgcgcttc ttgaagttat agctacatca ttgacgaaag ctgcggatgg gaatgcctcc       300
     atcgtctcaa aagcgaagaa actccttagt cgggtagatg gatttagggc aatggggttc       360
     ttggctgaag gagcggcttt atttgccgga gttcctactg ggggctttct tgctagaggt       420
     ttgggagcat taagaaatgt ttcagatgga atacaaagtc aggaagagta cgaagattta       480
     ggcaatctgg ctaaagaaag taaggagaag gttggtaatt tgctcaagcc agaggtgaaa       540
     aaaagccctc ctcaacagat tgaagctttc cgtaaggaat atggggaaat tttagaagag       600
     cttggtaagc cacttatagt gataatagat aatcttgatc gctgcctccc tgctaacgct       660
     attcatacgc ttgaagctat caggttattc cttttcttaa ctaatactgc ctttatcatt       720
     gcagcagatg aggacatgat tcgttcttct gtgtctgatt acttcaaggg ggcatcacag       780
     cgccatcaga tagattatct cgataagctc atccaggttc ctattcgggt gccaaaagct       840
     ggagtgcgtg agattcgttc atatctgttc atgctttatg ctattgaaca tggcttaaaa       900
     ggcgaaaaac ttaccaatct ccgtgatggt ttagaaaggg cattacagca ttcctggaaa       960
     gatgaaccaa tctcacgcca ggacgtcctg aaaatgactg gtgaatccga ggatagtaat      1020
     ctagctttgg catttgcacg tgcggaccgt attgctcctg tattagcgaa ctctccaata      1080
     atccatggca atcccagaat cgttaagcgt ttgctgaatg ttgtgaaaat gcgttctcaa      1140
     attgctaagc gacgagcaat gcctttggat gaagcaatta tcactaagtt agtaatcttt      1200
     gaacgatgtg tcggagtaga tggtactgct gatttatatc acctcgtgga tattgaacaa      1260
     ggtatgcccc agctactaaa acagcttgag gatactaacg gtcaagtacc ttcggaagcg      1320
     ccaaagacat ggactgataa tccaacaact aaagctttca ttgctcaatg ggctcagctt      1380
     gaaccgcgcc ttggtggaat tgatttgaga gccgctatat acctatccag agaaactatg      1440
     ccaataggtg catatgtggt cggtttatca ccatctggac gggaagtact gaatgcactt      1500
     attgaactga aaaataccag ttctcctaca gcagaagacc ttttgaaaac gcttcctcgt      1560
     gaagagcaag tacctgtaat ggaaggttta attagccaat taaggcaagt gtcagattgg      1620
     gctcgtaaac ctaagggttt ttccggtgca tgcctcttag cccgccattc ggcagatgcg      1680
     gccagtatat taattcgttt tttgcaggag ttgcaactgg ggatgaaacg gccagcgtgg      1740
     atgactgcag cactaaaaga tgagcaatgg aataaggacg cttaa                      1785
//

If you have problems or comments...

PBIL Back to PBIL home page