(data stored in ACNUC7421 zone)

EMBL: FN667743.PE121

FN667743.PE121       Location/Qualifiers
FT   CDS_pept        109829..111157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0121"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92989"
FT                   /db_xref="GOA:D3VM37"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92989.1"
FT                   /translation="MARMGGLPMTQLVFHHDHRLLPSAGDSLLPVQLYGLSGQGRGDIS
FT                   IIGNPAIDRIKRLGVKIPAQVMDFLSIALAVTAADTFVQRESSEDGWTRQFSLRLPLHE
FT                   PSRWIALKKELESALHFLSGDIWDFEFCNGGYVPPEPYSQHSKFHLIKLKDLDCVSLFS
FT                   GGLDSAIGAIDLLAAGRAPLLVSHAYKGDKSRQDQIAEKLNGRYSRFEINADPHIYQGD
FT                   TEITMRTRSLNFLAFAAVGACAVQEVSQQEKVDLFVPENGFISLNAPLTPRRIGTLSTR
FT                   TTHPHFITSVQKLFDAAGIPCQIINPYQFKTKGQMASQCLNKQLLSEVVESTVSCSHWK
FT                   RRNQQCGVCVPCIIRRASLHAGGIDKDADYTFQSLAKVINEIDRRDDLMALRIAIAQKS
FT                   TLKIGTWIAKSGPLPTATFNNFKQVFIDGLDEVESYLLSESIV"
     ttggcaagaa tgggaggctt accaatgaca caattagttt tccatcatga tcatcgtctc        60
     ttaccgtcag caggtgatag cttgttgccc gtacagctct atggattaag cgggcagggt       120
     cggggtgata tatctattat tgggaatcct gcgattgatc gaattaagcg cttgggagtc       180
     aaaattccag ctcaggtcat ggattttttg agcatcgcac tagcggttac agccgccgat       240
     accttcgttc agcgtgaaag ctctgaggat ggttggactc gccaattctc gttacgactt       300
     ccccttcatg agccatctcg atggattgct cttaagaagg agcttgaaag cgctttgcat       360
     ttccttagtg gagacatctg ggattttgaa ttttgtaacg gtggttatgt accaccagaa       420
     ccgtatagcc agcattcaaa atttcatctg attaaactca aagatcttga ctgcgtcagc       480
     ttattttcgg gcggattgga ttcggctatt ggcgcaatag atcttcttgc agcagggcgt       540
     gccccgcttt tggttagtca tgcttataaa ggagacaagt cacgccaaga tcagattgct       600
     gaaaaattaa atggtcgata ctcacggttt gaaattaatg ctgatccgca tatatatcaa       660
     ggtgatactg agattacgat gcgaacgcgt agcctcaatt ttcttgcctt tgcggctgtt       720
     ggcgcttgtg ctgtacaaga agtatctcaa caagaaaagg tcgatctgtt tgtgcctgaa       780
     aatgggttta tctcgctaaa tgcgccacta accccacgaa ggataggtac gctgagcaca       840
     cgaactacac atccacattt tattacgagc gtacaaaagc tctttgatgc ggccggtatt       900
     ccttgccaaa taatcaatcc atatcagttc aaaacaaagg ggcaaatggc ctcccaatgc       960
     ttgaataagc aactattatc tgaagtcgtg gaaagtacag tatcttgcag tcattggaaa      1020
     cgccggaatc agcagtgcgg agtgtgtgta ccgtgcatca ttcgacgggc atcgcttcat      1080
     gctgggggga ttgataaaga cgctgattat acttttcagt ccctagctaa agtaataaat      1140
     gaaattgatc gcagggatga tctcatggct cttaggattg cgatcgcaca gaaatcgact      1200
     ttgaaaatag gaacatggat cgccaaaagc ggtcctttgc ctacggcaac attcaataat      1260
     tttaagcagg tgtttataga cggcctggat gaggtcgaaa gctacttact aagtgagagc      1320
     atagtgtga                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page