(data stored in ACNUC7421 zone)

EMBL: FN667743.PE122

FN667743.PE122       Location/Qualifiers
FT   CDS_pept        111154..111879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0122"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92990"
FT                   /db_xref="GOA:D3VM38"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92990.1"
FT                   /translation="MSIDMHCHLDLYSQPEQVAEECKRRGTYILSVTTTPRAWHGTSSL
FT                   AKGSQRIRTALGLHPQIAHQRSHELELFDSLLSETRYIGEIGLDGGKGFKEHWDIQLKV
FT                   FRHILNNVNRAGGKIMTIHSRGSASVVLDEIENIDGVAVLHWFTGTPKQLERAIDLGCW
FT                   FSVGPAMLDTIKGKSLALKIPKSRILTETDGPFGKFRNDPLMPWDSEIAEKQLTTLWDM
FT                   SQMEVKAQLFENFRELCKL"
     gtgagcatcg atatgcactg tcatctcgac ttatattctc agccagaaca agtggctgag        60
     gaatgcaagc gtcgagggac ttatatactg tcggttacaa cgacacctag agcatggcat       120
     gggacctctt cactagccaa aggaagccaa cgaatccgaa cagctcttgg gcttcatccc       180
     caaatagcac atcaaagatc gcatgagtta gagctatttg attcactgct ttcggaaact       240
     aggtacattg gcgaaatagg gcttgatggt ggtaagggat ttaaagagca ttgggacatc       300
     cagttgaagg tattccgaca catactcaat aacgtaaatc gtgctggagg caagattatg       360
     actatccata gccgaggaag tgcgtcagtt gtcctcgatg agatcgaaaa tattgatggg       420
     gtagcagtat tgcattggtt cacagggaca cctaagcagc ttgaaagggc aatcgattta       480
     gggtgttggt tttcagtggg gccagcaatg ctcgatacaa taaagggaaa gtccttagct       540
     ttgaaaattc ccaaatcacg cattcttaca gaaacagatg ggccatttgg taagtttcgt       600
     aatgacccac taatgccatg ggacagtgag attgcagaga agcagctaac cacattatgg       660
     gacatgagcc agatggaggt taaagctcag ctttttgaaa attttagaga gttatgtaaa       720
     ttgtaa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page