(data stored in ACNUC7421 zone)

EMBL: FN667743.PE131

FN667743.PE131       Location/Qualifiers
FT   CDS_pept        complement(116607..117017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0131"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0131"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92999"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92999.1"
FT                   /translation="MLSDFITFSSMDEEKCQPYLGRDRVSKNAPELGAELLDSLTSTKW
FT                   YIWHGNVIKALEHLDDCAAMCDEDISHYGNNKSLLKHIDEMYTYIENNSMMIPNYGEMY
FT                   RYGEAISSSFVESTINEVIAKRMVKKQQMQWS"
     ttgctttctg atttcataac attctcctca atggatgaag aaaagtgtca accttattta        60
     ggacgggaca gggtatcaaa aaacgcccct gaacttggtg cagaattatt ggactcttta       120
     accagcacaa aatggtatat ctggcatgga aatgtgatta aggcattaga acacctggat       180
     gattgtgcgg caatgtgtga tgaggacata tcgcattatg gtaataataa atcattgtta       240
     aaacatatag atgaaatgta tacctatatt gaaaataaca gcatgatgat cccgaattac       300
     ggtgaaatgt accgatatgg tgaagcaatt tcctcttcat ttgttgaatc gacgatcaat       360
     gaagttatcg ctaaacggat ggtgaaaaag cagcagatgc aatggagcta g                411
//

If you have problems or comments...

PBIL Back to PBIL home page