(data stored in ACNUC7421 zone)

EMBL: FN667743.PE133

FN667743.PE133       Location/Qualifiers
FT   CDS_pept        117402..118250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0133"
FT                   /product="Integrase, catalytic domain (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0133"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93001"
FT                   /db_xref="GOA:D3VM49"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM49"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93001.1"
FT                   /translation="MTQCCRYLGITRQAYYQQCQRTAIKEQQEQDTLRQVQSIRLKQPR
FT                   IGTRKLQYLLNQSSPLKIGRDSLFDLLRTHHLLVRPKRAYHKTTQSHHRFYCHPNLLKA
FT                   GSNKITPTGPEQVWVADITYLPVKMGEAYLSLITDAWSRKIVGHHVHDNLKTDAVIKAY
FT                   KQALKNRKLAEKSRIHHSDRGLQYCSKRYQALHKHHEVICSMTDGHDCYQNALAERVNG
FT                   ILKTEFLLSKPSDLEEAIKMVSESIEIYNRYRPHLALKYKTPDEVHHQALSKNSVNVYQ
FT                   D"
     gtgactcaat gttgccgtta tctgggtatc acacggcaag cttattatca gcaatgtcag        60
     cggacagcca tcaaagaaca acaggaacag gataccttga ggcaagtgca gtcaatccgc       120
     ctgaagcagc cccgtattgg cacgagaaag cttcagtatt tgttgaatca atcaagccca       180
     ttaaaaatag gcagagacag cctgttcgac ttactcagaa cccatcattt gttagtcaga       240
     cccaaacggg cttaccacaa aacgacgcag agtcatcatc gtttttactg ccaccctaat       300
     ttacttaaag cgggttctaa taagataacc ccaacggggc cagaacaagt ttgggtggct       360
     gatattacgt atcttcccgt gaaaatgggg gaagcatatt taagcctgat tacggatgcc       420
     tggtcacgta aaatcgtggg gcatcatgtg catgataact taaaaacaga cgcggttatc       480
     aaggcgtaca agcaggcctt aaaaaaccga aaattagccg aaaaatcacg gatccatcat       540
     tcagacagag ggttacaata ttgttcaaaa cgctatcagg cgctacataa gcaccatgaa       600
     gtgatttgtt caatgacaga tggtcacgat tgctatcaga atgcgttggc agagcgtgtt       660
     aatggcatcc tgaaaacaga atttttactc agtaaaccgt ctgatcttga agaagcgatc       720
     aaaatggtga gtgaatcgat agaaatttat aatcggtatc ggccgcactt agcgctaaaa       780
     tataaaacgc cggatgaagt tcatcatcag gcgttaagta aaaatagtgt caacgtatat       840
     caggactag                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page