(data stored in ACNUC7421 zone)

EMBL: FN667743.PE140

FN667743.PE140       Location/Qualifiers
FT   CDS_pept        complement(124507..125478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0140"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0140"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93008"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93008.1"
FT                   /translation="MYGINFILSIILFKWRLIMNIIQKNSSNIIWGDETDSGQLGHFYP
FT                   FLFPFTIGDHTFFYGQNIERSRYGRFIRELHPGGIVSWTTDETDINYGPSLSIRPVLYT
FT                   VGKRVFIRAQMIDHHKLWYIQEVLPGGTFGSIINQGYYNIEYSAQFPYLIDGKTFIFNQ
FT                   TFDEKKGNFYIVQEMMPDGNHGEITDEGTWNSFYPFQFAYTVGKRTFYYGQTRDNNYWF
FT                   IQELLPDGRIGSTTESGNWHSFYEVLFPFIFKGRTFYYGQTRDNNYWFIQELLADGKLA
FT                   SSYQSGYFEHFYEVQFPFTFGEHTYFFRHSNDKRWFIQELLL"
     atgtatggca ttaattttat cttaagcata attttattta aatggagact tatcatgaat        60
     attattcaaa aaaactcttc gaatataatt tggggagatg aaacagattc gggtcaattg       120
     ggacattttt atccttttct gtttcccttt acgattgggg atcatacgtt tttttatggc       180
     caaaacatag aaagatctcg ttatggtaga tttattcggg aacttcaccc cggtggcata       240
     gtgagttgga caacagatga aacagatata aattatgggc cttctctttc tattaggccg       300
     gttctttata ccgttggaaa gcgtgtattt atacgtgctc aaatgattga ccatcataag       360
     ctatggtaca ttcaagaagt gttaccaggt ggaacattcg gctccataat aaatcaaggc       420
     tattataata ttgaatattc tgcacagttt ccctatttaa ttgatgggaa gacatttata       480
     tttaatcaga cttttgatga aaaaaaaggt aacttttata tagttcaaga aatgatgccc       540
     gacggtaatc atggtgaaat aacggacgaa ggaacatgga actcgtttta ccctttccag       600
     tttgcttata cagttggaaa gcgcactttc tattatggac aaaccagaga taataactat       660
     tggttcattc aggaactttt gcctgacggt agaataggga gcaccactga aagcggaaat       720
     tggcacagtt tttatgaggt gctatttccc ttcattttta aagggcgcac tttctattat       780
     ggacaaacca gagataataa ctattggttt attcaggaac ttctggctga cggcaagctg       840
     gcgagcagct atcaatcagg atattttgag catttttatg aggttcaatt ccccttcact       900
     tttggagagc atacttactt ctttcggcac agcaatgata aaaggtggtt tattcaagaa       960
     ctactattat ag                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page