(data stored in ACNUC7421 zone)

EMBL: FN667743.PE142

FN667743.PE142       Location/Qualifiers
FT   CDS_pept        complement(126116..126265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0142"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0142"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93010"
FT                   /db_xref="GOA:D3VM24"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93010.1"
FT                   /translation="MSDGISKYSPSRVGYARVSSISQNLDSQIDALKTAGCGKIFTDKM
FT                   TVHA"
     atgagtgacg gaatatcaaa atattctcca agtcgtgtgg ggtatgcccg ggtcagtagc        60
     atcagccaaa atctggattc acaaattgat gccttaaaaa cagcgggctg cggaaaaata       120
     tttaccgaca aaatgacggt tcacgcatga                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page